Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|557000
Gene name
Locationscaffold_01a:475730..476524
Strand-
Gene length (bp)794
Transcript length (bp)423
Coding sequence length (bp)423
Protein length (aa) 141

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 6.7E-08 11 50
PF00023 Ank Ankyrin repeat 3.0E-04 54 87
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.6E-06 13 87

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54KH3|ANR39_DICDI Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 2 98 1.0E-08
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 12 105 8.0E-08
sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 13 97 1.0E-07
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 15 100 2.0E-07
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 14 111 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54KH3|ANR39_DICDI Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 2 98 1.0E-08
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 12 105 8.0E-08
sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 13 97 1.0E-07
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 15 100 2.0E-07
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 14 111 8.0E-07
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 4 136 7.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 23 113 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|557000
MSNGATPEERLLAAARNDDEDNLQLAIEDGADINCRDGAGDTPLHLAVKHDMTGKTPLHYAIESESEYRTSIIDS
LLEAGADTRVKDKHGTTAAELVRPDDTEVLTLIRKANAQNTISRSDIADDDDDDEDGEGSGSDSG*
Coding >Agabi119p4|557000
ATGAGCAACGGCGCTACGCCTGAGGAACGGCTACTAGCCGCTGCACGCAATGATGATGAAGATAACCTGCAGCTC
GCTATCGAGGACGGTGCAGACATCAATTGTCGGGACGGGGCTGGCGATACTCCTCTACATCTTGCGGTAAAACAC
GATATGACAGGGAAGACTCCCCTTCACTATGCTATCGAGTCAGAGAGCGAGTATCGCACAAGCATTATAGATTCG
TTGCTCGAGGCTGGCGCGGACACGAGAGTCAAGGACAAGCACGGCACAACGGCGGCAGAACTTGTGCGCCCCGAT
GACACCGAGGTTCTTACGCTCATTCGCAAGGCTAATGCACAGAACACGATAAGCCGCTCGGACATCGCCGACGAC
GATGACGACGACGAGGACGGAGAAGGATCAGGATCTGATTCGGGGTGA
Transcript >Agabi119p4|557000
ATGAGCAACGGCGCTACGCCTGAGGAACGGCTACTAGCCGCTGCACGCAATGATGATGAAGATAACCTGCAGCTC
GCTATCGAGGACGGTGCAGACATCAATTGTCGGGACGGGGCTGGCGATACTCCTCTACATCTTGCGGTAAAACAC
GATATGACAGGGAAGACTCCCCTTCACTATGCTATCGAGTCAGAGAGCGAGTATCGCACAAGCATTATAGATTCG
TTGCTCGAGGCTGGCGCGGACACGAGAGTCAAGGACAAGCACGGCACAACGGCGGCAGAACTTGTGCGCCCCGAT
GACACCGAGGTTCTTACGCTCATTCGCAAGGCTAATGCACAGAACACGATAAGCCGCTCGGACATCGCCGACGAC
GATGACGACGACGAGGACGGAGAAGGATCAGGATCTGATTCGGGGTGA
Gene >Agabi119p4|557000
ATGAGCAACGGCGCTACGCCTGGTAAACTTTGTTCATCTGTAATACTTTCGCTGACTTATCTTTCGGCGTTTAGA
GGAACGGCTACTAGCCGCTGCACGCAATGATGATGAAGATAACCTGCAGCTCGCTATCGAGGACGGTGCAGACAT
CAATTGTCGGGACGGGTGAGCAAAGACCCGGGGTAGAAACGGCCGATCTGTAATATGCTGACCCGTTGTTACATA
GGGCTGGCGATACTCGTATGTCGCGTCTCTACCACACATATCATATCTAACAAAGGGTCGCAGCTCTACATCTTG
CGTACGCTATCTCTCTGAATCTGCTCCTCGATTTCTCACCGTCTCAAGGGTAAAACACGAGTCTGTTGGTATTCT
TGAGGATATTCTGAGCCATGACGAATGCGATGTCGACCCGGCAAACAGTATGACAGGGAAGACTCCCCTTCACTA
TGCTATCGAGTCAGAGAGCGAGTATCGCACAAGCATTATAGATTCGTTGCTCGAGGCTGGCGCGGACACGAGGTA
GGCGGTGGATCTAACGCTGAACAGGATTAATGGTGTGGGACATTTAGAGTCAAGGACAAGCACGGCACAACGGCG
GCAGAACTTGTGCGCCCCGATGACACCGAGGTTCTTACGCTCATTCGCAAGGCTAATGCACAGAACACGATAAGC
CGCTCGGACATCGCCGGTGAGTGACCTTTGTGTGCGATGACAACGACTGTACTGACGTGCTCGCAGACGACGATG
ACGACGACGAGGACGGAGAAGGATCAGGATCTGATTCGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail