Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|555450
Gene name
Locationscaffold_01a:266905..267675
Strand+
Gene length (bp)770
Transcript length (bp)537
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit 1.3E-21 56 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74882|SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh3 PE=3 SV=1 12 174 4.0E-35
sp|P70097|C560_CRIGR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Cricetulus griseus GN=SDHC PE=2 SV=1 20 173 8.0E-20
sp|P33421|SDH3_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH3 PE=1 SV=1 47 166 2.0E-19
sp|Q04487|SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH3 PE=3 SV=1 36 175 2.0E-17
sp|P80481|C560_RECAM Succinate dehydrogenase cytochrome b560 subunit OS=Reclinomonas americana GN=SDH3 PE=3 SV=1 49 173 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74882|SDH3_SCHPO Succinate dehydrogenase cytochrome B subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh3 PE=3 SV=1 12 174 4.0E-35
sp|P70097|C560_CRIGR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Cricetulus griseus GN=SDHC PE=2 SV=1 20 173 8.0E-20
sp|P33421|SDH3_YEAST Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH3 PE=1 SV=1 47 166 2.0E-19
sp|Q04487|SHH3_YEAST Mitochondrial inner membrane protein SHH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH3 PE=3 SV=1 36 175 2.0E-17
sp|P80481|C560_RECAM Succinate dehydrogenase cytochrome b560 subunit OS=Reclinomonas americana GN=SDH3 PE=3 SV=1 49 173 5.0E-16
sp|P35720|C560_BOVIN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Bos taurus GN=SDHC PE=1 SV=2 14 175 5.0E-16
sp|P41955|C560_CAEBR Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis briggsae GN=mev-1 PE=2 SV=1 39 168 6.0E-16
sp|P41956|C560_CAEEL Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Caenorhabditis elegans GN=mev-1 PE=2 SV=1 49 166 1.0E-15
sp|P35721|C560_MARPO Succinate dehydrogenase cytochrome b560 subunit OS=Marchantia polymorpha GN=SDH3 PE=3 SV=1 55 168 2.0E-15
sp|D0VWV4|C560_PIG Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Sus scrofa GN=SDHC PE=1 SV=2 14 175 3.0E-15
sp|Q9CZB0|C560_MOUSE Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Mus musculus GN=Sdhc PE=1 SV=1 14 161 3.0E-14
sp|Q99643|C560_HUMAN Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Homo sapiens GN=SDHC PE=1 SV=1 14 161 8.0E-14
sp|Q8T2T5|C560_DICDI Succinate dehydrogenase cytochrome b560 subunit, mitochondrial OS=Dictyostelium discoideum GN=sdhC PE=3 SV=1 59 177 1.0E-13
sp|P41085|DHSC_RICPR Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia prowazekii (strain Madrid E) GN=sdhC PE=3 SV=1 49 175 6.0E-12
sp|Q68XP1|DHSC_RICTY Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sdhC PE=3 SV=1 49 175 1.0E-11
sp|Q92J99|DHSC_RICCN Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sdhC PE=3 SV=1 49 175 2.0E-11
sp|Q1RHB5|DHSC_RICBR Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia bellii (strain RML369-C) GN=sdhC PE=3 SV=1 49 175 3.0E-11
sp|P48935|C560_CYACA Succinate dehydrogenase cytochrome b560 subunit OS=Cyanidium caldarium GN=SDH3 PE=3 SV=1 58 152 1.0E-10
sp|Q4UKC1|DHSC_RICFE Succinate dehydrogenase cytochrome b556 subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sdhC PE=3 SV=1 49 175 1.0E-09
sp|P80478|C560_PORPU Succinate dehydrogenase cytochrome b560 subunit OS=Porphyra purpurea GN=SDH3 PE=3 SV=1 56 148 8.0E-09
sp|P48934|C560_CHOCR Succinate dehydrogenase cytochrome b560 subunit OS=Chondrus crispus GN=SDH3 PE=3 SV=1 58 155 1.0E-07
sp|P0DKI1|SDH32_ARATH Succinate dehydrogenase subunit 3-2, mitochondrial OS=Arabidopsis thaliana GN=SDH3-2 PE=1 SV=1 59 106 4.0E-06
sp|P0DKI0|SDH31_ARATH Succinate dehydrogenase subunit 3-1, mitochondrial OS=Arabidopsis thaliana GN=SDH3-1 PE=1 SV=1 59 106 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 78 100 22
2 158 177 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|555450
MSTKVLGLGPTFRRAALNPRLALRNQVVLRNGIGRRLIQTESLSPSASEGILNKQRLSRPMSPHLTIYQPQLTSV
VSIFNRFAGAGLGILLYGFGLAYLVAPTTFDSVHLLTFIHELPEVVKLGGKFILAAPFSLHFFNGLRHLAWDAGK
LMSLKGVYTGGYVVLGAATASTVYLTFF*
Coding >Agabi119p4|555450
ATGTCGACCAAGGTTCTTGGGTTGGGTCCTACGTTTAGGCGCGCTGCTTTGAACCCCCGACTAGCTCTGAGAAAC
CAGGTCGTACTGCGCAATGGCATTGGCAGGAGGTTGATTCAAACAGAATCCTTATCTCCCTCAGCGAGCGAAGGA
ATACTCAACAAACAACGCCTCAGCCGTCCTATGAGTCCTCATCTGACAATCTATCAACCTCAATTGACTTCTGTC
GTTTCGATTTTTAACCGATTTGCTGGTGCGGGTCTCGGCATCCTGCTTTATGGATTTGGTCTTGCCTACCTTGTT
GCGCCTACGACTTTTGATAGTGTGCACTTGTTGACGTTTATCCATGAACTCCCGGAAGTTGTCAAGTTGGGTGGG
AAATTTATTCTCGCTGCGCCGTTTTCACTTCACTTTTTCAATGGGTTGAGGCATTTGGCCTGGGATGCTGGAAAA
CTGATGAGTTTGAAAGGGGTTTATACGGGTGGATATGTTGTACTTGGAGCCGCTACAGCCTCGACTGTTTATCTA
ACGTTTTTCTGA
Transcript >Agabi119p4|555450
ATGTCGACCAAGGTTCTTGGGTTGGGTCCTACGTTTAGGCGCGCTGCTTTGAACCCCCGACTAGCTCTGAGAAAC
CAGGTCGTACTGCGCAATGGCATTGGCAGGAGGTTGATTCAAACAGAATCCTTATCTCCCTCAGCGAGCGAAGGA
ATACTCAACAAACAACGCCTCAGCCGTCCTATGAGTCCTCATCTGACAATCTATCAACCTCAATTGACTTCTGTC
GTTTCGATTTTTAACCGATTTGCTGGTGCGGGTCTCGGCATCCTGCTTTATGGATTTGGTCTTGCCTACCTTGTT
GCGCCTACGACTTTTGATAGTGTGCACTTGTTGACGTTTATCCATGAACTCCCGGAAGTTGTCAAGTTGGGTGGG
AAATTTATTCTCGCTGCGCCGTTTTCACTTCACTTTTTCAATGGGTTGAGGCATTTGGCCTGGGATGCTGGAAAA
CTGATGAGTTTGAAAGGGGTTTATACGGGTGGATATGTTGTACTTGGAGCCGCTACAGCCTCGACTGTTTATCTA
ACGTTTTTCTGA
Gene >Agabi119p4|555450
ATGTCGACCAAGGTTCTTGGGTTGGGTCCTACGTTTAGGCGCGCTGCTTTGAACCCCCGACTAGGTGAGTTATGT
CGGAGCTATTCTGCGTTGTGATATTATTTACTTGATGCTAGCTCTGAGAAACCAGGTCGTACTGCGCAATGGCAT
TGGCAGGAGGTATGTTTTTGAATCAAAGCAATAGAGAGTTTGGAAATTGATAATTTTGCTTAGGTTGATTCAAAC
AGAATCCTTATCTCCCTCAGCGAGCGAAGGAATACTCAACAAACAACGCCTCAGCCGTCCTATGAGTCCTCATCT
GACAATCTATCAACCTCAATTGACTTCTGTCGTTTCGATTTTTAACCGATTTGCTGGTGCGGGTCTCGGCATCCG
TATGTATCCTTTCCTCTTTTTTTTTTACAATTTCAGACTGGACGGTTGGTTGTTATTATTTAGTGCTTTATGGAT
TTGGTCTTGCCTACCTTGTTGCGCCTACGACTTTTGATAGTGTGCACTTGTTGACGTTTATCCATGAACTCCCGG
AAGTTGTCAAGTTGGGTGGGAAATTTATTCTCGCTGCGCCGTTTTCACTTCACTTTTTCAATGGGTTGAGGCATT
TGGCCTGGGATGCTGGAAAACGTACGTGCTTTGAATACCTGGTTTTCTCATGCGTTTTCTTATGCTGATGGTCTC
TGGGGACAGTGATGAGTTTGAAAGGGGTTTATACGGGTGGATATGTTGTACTTGGAGCCGCTACAGCCTCGACTG
TTTATCTAACGTTTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail