Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|553800
Gene name
Locationscaffold_01a:80230..81436
Strand-
Gene length (bp)1206
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 4.0E-19 104 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 34 264 2.0E-12
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 34 264 2.0E-12
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 3 222 2.0E-11
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 16 264 3.0E-11
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 121 223 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 34 264 2.0E-12
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 34 264 2.0E-12
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 3 222 2.0E-11
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 16 264 3.0E-11
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 121 223 1.0E-08
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 121 223 1.0E-08
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 106 243 3.0E-08
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 106 243 7.0E-08
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 106 243 1.0E-07
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 106 239 2.0E-07
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 13 232 7.0E-07
sp|Q941F1|PLA15_ARATH Phospholipase A1-Igamma1, chloroplastic OS=Arabidopsis thaliana GN=At1g06800 PE=1 SV=2 117 225 8.0E-07
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 106 232 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|553800
MLLSSILIVFWALTSVNAGTIAGEYRRATIEELTPVQISQFTPFTRFASAAYCSLEAMSLWTCGADCEANSNFIP
TATGGDGGFVQRWYVGYSPENRGDYTLPVLVHGGFALQHARAAKAILSAVKITIARHNATKVALVGHSLGGAIAL
LDSVYLPLHIKGVEFHTITYGLPRVGNIAFANYVDEHTSLTRINNKRDPIPTTPLQLLSYRHPSGEVHITGGNKW
LACPGQENPSFRCTFGSVPLFLVGNPLDHHGSYNGVNMGDGC*
Coding >Agabi119p4|553800
ATGTTGCTTTCCAGCATTCTCATCGTTTTCTGGGCTTTGACCTCTGTCAATGCTGGCACGATAGCGGGAGAATAT
AGACGAGCGACCATCGAGGAATTGACACCCGTGCAAATTTCCCAATTTACCCCTTTCACTCGGTTTGCAAGTGCC
GCATATTGCTCTCTTGAGGCTATGTCATTATGGACTTGTGGAGCTGATTGTGAAGCTAATTCTAATTTCATACCC
ACCGCTACGGGTGGGGATGGTGGATTCGTTCAACGATGGTACGTTGGATATTCACCTGAGAATCGAGGCGATTAT
ACTTTACCAGTATTAGTGCATGGTGGTTTTGCTTTGCAGCATGCCAGGGCCGCGAAAGCGATTTTGTCGGCTGTT
AAGATCACCATCGCAAGGCACAATGCAACCAAAGTGGCGCTAGTTGGTCACTCACTCGGTGGTGCCATTGCTTTA
CTTGATAGCGTGTACCTTCCCCTTCACATCAAAGGCGTCGAATTCCACACAATCACATATGGTCTACCAAGGGTA
GGGAACATCGCGTTCGCGAACTACGTTGATGAACACACATCTCTCACCCGGATAAACAATAAAAGAGATCCTATC
CCCACCACTCCACTTCAACTTTTAAGTTATCGCCACCCTTCTGGCGAGGTTCATATTACAGGAGGAAACAAATGG
CTTGCTTGTCCCGGACAGGAGAACCCAAGTTTTCGATGCACTTTTGGGAGTGTGCCGTTATTTCTTGTAGGTAAT
CCTCTTGACCATCACGGTTCTTATAACGGTGTCAACATGGGCGACGGATGTTGA
Transcript >Agabi119p4|553800
ATGTTGCTTTCCAGCATTCTCATCGTTTTCTGGGCTTTGACCTCTGTCAATGCTGGCACGATAGCGGGAGAATAT
AGACGAGCGACCATCGAGGAATTGACACCCGTGCAAATTTCCCAATTTACCCCTTTCACTCGGTTTGCAAGTGCC
GCATATTGCTCTCTTGAGGCTATGTCATTATGGACTTGTGGAGCTGATTGTGAAGCTAATTCTAATTTCATACCC
ACCGCTACGGGTGGGGATGGTGGATTCGTTCAACGATGGTACGTTGGATATTCACCTGAGAATCGAGGCGATTAT
ACTTTACCAGTATTAGTGCATGGTGGTTTTGCTTTGCAGCATGCCAGGGCCGCGAAAGCGATTTTGTCGGCTGTT
AAGATCACCATCGCAAGGCACAATGCAACCAAAGTGGCGCTAGTTGGTCACTCACTCGGTGGTGCCATTGCTTTA
CTTGATAGCGTGTACCTTCCCCTTCACATCAAAGGCGTCGAATTCCACACAATCACATATGGTCTACCAAGGGTA
GGGAACATCGCGTTCGCGAACTACGTTGATGAACACACATCTCTCACCCGGATAAACAATAAAAGAGATCCTATC
CCCACCACTCCACTTCAACTTTTAAGTTATCGCCACCCTTCTGGCGAGGTTCATATTACAGGAGGAAACAAATGG
CTTGCTTGTCCCGGACAGGAGAACCCAAGTTTTCGATGCACTTTTGGGAGTGTGCCGTTATTTCTTGTAGGTAAT
CCTCTTGACCATCACGGTTCTTATAACGGTGTCAACATGGGCGACGGATGTTGA
Gene >Agabi119p4|553800
ATGTTGCTTTCCAGCATTCTCATCGTTTTCTGGGCTTTGACCTCTGTCAATGCTGGCACGATAGCGGGAGAATAT
AGACGAGCGACCATCGAGGAATTGACACCCGTGCAAATTTCCCAATTTACCCCTTTCACTCGGTTTGCAAGTGCC
GCATATTGCTCTCTTGAGGCTATGTCATTATGGACTTGTGGAGGTGACTTTGGTCTAGGTCCACGTCTGTCATTT
ACATCTGCTCAAATTCAATGCTTGCTAGCTGATTGTGAAGCTAATTCTAATTTCATACCCACCGCTACGGGTGGG
GATGGTGGATTCGTTCAACGATGTACGTACACCGCCTTTGGCATTTTTAAAAATTTTATTTCTGTCTATATTGGA
TACTCAATAACATCAGGGTACGTTGGATATTCACCGTCTCTACAATCAGTCGTGGTGGCCCATCAGGGAACTGAT
CCAGTGAGAATGTTCGTATACTATACAGATCGCATATCTTTCGTGTCATTTATTCAAGAATTACCCAGCGAGGCG
ATTATACTTTACCAGTATTAGTGCATGGTGGTTTTGCTTTGCAGCATGCCAGGTAAGTTCATCTTCGATTCACTT
CTTCTGTTATCATTGTAGGCCTGAGGGAAATATTAGGGCCGCGAAAGCGATTTTGTCGGCTGTTAAGATCACCAT
CGCAAGGCACAATGCAACCAAAGTGGCGCTAGTTGGTCACTCACTCGGTGGTGCCATTGCTTTACTTGATAGCGT
GTACCTTCCCCTTCACATCAAAGGCGTCGAATTCCACACAATCACATATGGTCTACCAAGGGTAATATCCTCTCC
CTTTGTGTGACAATGCAATCTGCGCTAATATAGACGGGTCGTAGGTAGGGAACATCGCGTTCGCGAACTACGTTG
ATGAACACACATCTCTCACCCGGATAAACAATAAAAGAGATCCTATCCCCACCACTCCACGTAAGTATTAGTACG
CAAATTTGAACAATGGGGCTTTTCTTTAATTTTTATTTAGTTCAACTTTTAAGTTATCGCCACCCTTCTGGCGAG
GTTCATATTACAGGAGGAAACAAATGGCTTGCTTGTCCCGGACAGGAGAACCCAAGTTTTCGATGCACTTTTGGG
AGTGTGCCGTTATTTCTTGTAGGTAATCCTCTTGACCATCACGGTTCTTATAACGGTGTCAACATGGGCGACGGA
TGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail