Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|119120
Gene name
Locationscaffold_09:1639145..1640764
Strand+
Gene length (bp)1619
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal 2.5E-15 26 107
PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily 3.0E-06 185 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 25 323 3.0E-12
sp|Q07512|FLS_PETHY Flavonol synthase/flavanone 3-hydroxylase OS=Petunia hybrida GN=FL PE=2 SV=1 26 242 3.0E-11
sp|Q9FFQ4|FLS5_ARATH Probable flavonol synthase 5 OS=Arabidopsis thaliana GN=FLS5 PE=2 SV=1 24 242 2.0E-10
sp|Q4PT02|GAOX5_ARATH Gibberellin 20 oxidase 5 OS=Arabidopsis thaliana GN=GA20OX5 PE=2 SV=1 25 292 2.0E-10
sp|P10621|IPNS_STRC2 Isopenicillin N synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pcbC PE=3 SV=1 24 241 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LL04|YQK1_SCHPO UPF0676 protein C1494.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1494.01 PE=3 SV=2 25 323 3.0E-12
sp|Q07512|FLS_PETHY Flavonol synthase/flavanone 3-hydroxylase OS=Petunia hybrida GN=FL PE=2 SV=1 26 242 3.0E-11
sp|Q9FFQ4|FLS5_ARATH Probable flavonol synthase 5 OS=Arabidopsis thaliana GN=FLS5 PE=2 SV=1 24 242 2.0E-10
sp|Q4PT02|GAOX5_ARATH Gibberellin 20 oxidase 5 OS=Arabidopsis thaliana GN=GA20OX5 PE=2 SV=1 25 292 2.0E-10
sp|P10621|IPNS_STRC2 Isopenicillin N synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pcbC PE=3 SV=1 24 241 3.0E-10
sp|O04395|FLS_MATIN Flavonol synthase/flavanone 3-hydroxylase (Fragment) OS=Matthiola incana PE=2 SV=1 26 242 4.0E-10
sp|Q9M547|FLS_EUSER Flavonol synthase/flavanone 3-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=FLS PE=2 SV=1 25 242 4.0E-10
sp|Q9C6I4|G2OX7_ARATH Gibberellin 2-beta-dioxygenase 7 OS=Arabidopsis thaliana GN=GA2OX7 PE=1 SV=1 26 266 5.0E-10
sp|Q06942|FL3H_MALDO Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus domestica PE=2 SV=1 25 244 6.0E-10
sp|P18286|IPNS_STRJU Isopenicillin N synthase OS=Streptomyces jumonjinensis GN=pcbC PE=3 SV=1 24 241 1.0E-09
sp|Q40061|IDS2_HORVU Mugineic-acid 3-dioxygenase OS=Hordeum vulgare GN=IDS2 PE=2 SV=1 26 241 5.0E-09
sp|Q9S818|FL3H_ARATH Naringenin,2-oxoglutarate 3-dioxygenase OS=Arabidopsis thaliana GN=F3H PE=1 SV=1 15 244 6.0E-09
sp|Q05965|FL3H_MATIN Naringenin,2-oxoglutarate 3-dioxygenase (Fragment) OS=Matthiola incana GN=FHT PE=2 SV=1 22 244 8.0E-09
sp|Q41452|FLS_SOLTU Flavonol synthase/flavanone 3-hydroxylase OS=Solanum tuberosum PE=2 SV=1 25 242 8.0E-09
sp|B2GVM7|FLAS2_ARATH Putative inactive flavonol synthase 2 OS=Arabidopsis thaliana GN=FLS2 PE=5 SV=1 14 242 2.0E-08
sp|Q9XFR9|G2OX2_ARATH Gibberellin 2-beta-dioxygenase 2 OS=Arabidopsis thaliana GN=GA2OX2 PE=2 SV=1 1 293 4.0E-08
sp|P31528|ACCO_DIACA Probable 1-aminocyclopropane-1-carboxylate oxidase OS=Dianthus caryophyllus GN=ACO PE=2 SV=1 24 242 4.0E-08
sp|Q54243|IPNS_STRGR Isopenicillin N synthase OS=Streptomyces griseus GN=pcbC PE=3 SV=1 24 241 1.0E-07
sp|Q9C971|G3OX4_ARATH Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=GA3OX4 PE=1 SV=1 26 295 2.0E-07
sp|O04274|LDOX_PERFR Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1 22 242 2.0E-07
sp|Q05963|FL3H_CALCH Naringenin,2-oxoglutarate 3-dioxygenase OS=Callistephus chinensis GN=FHT PE=2 SV=1 25 244 3.0E-07
sp|P41090|FL3H_VITVI Naringenin,2-oxoglutarate 3-dioxygenase OS=Vitis vinifera GN=F3H PE=2 SV=1 25 244 4.0E-07
sp|Q05964|FL3H_DIACA Naringenin,2-oxoglutarate 3-dioxygenase OS=Dianthus caryophyllus GN=FHT PE=2 SV=1 25 244 4.0E-07
sp|Q08507|ACCO3_PETHY 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Petunia hybrida GN=ACO3 PE=3 SV=1 25 242 6.0E-07
sp|Q08506|ACCO1_PETHY 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Petunia hybrida GN=ACO1 PE=1 SV=1 25 242 7.0E-07
sp|Q7XZQ8|FNSI_PETCR Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1 25 244 1.0E-06
sp|P12438|IPNS_STRMI Isopenicillin N synthase OS=Streptomyces microflavus GN=pcbC PE=3 SV=1 24 241 1.0E-06
sp|P31237|ACCO_ACTDE 1-aminocyclopropane-1-carboxylate oxidase OS=Actinidia deliciosa GN=ACO PE=2 SV=1 26 242 1.0E-06
sp|Q09052|ACCO1_BRAJU 1-aminocyclopropane-1-carboxylate oxidase OS=Brassica juncea GN=ACO PE=2 SV=1 26 242 2.0E-06
sp|Q41931|ACCO2_ARATH 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Arabidopsis thaliana GN=ACO2 PE=2 SV=2 26 242 3.0E-06
sp|Q39110|GAOX1_ARATH Gibberellin 20 oxidase 1 OS=Arabidopsis thaliana GN=GA20OX1 PE=2 SV=2 18 242 3.0E-06
sp|Q9C899|F6H2_ARATH Feruloyl CoA ortho-hydroxylase 2 OS=Arabidopsis thaliana GN=F6'H2 PE=1 SV=1 26 243 3.0E-06
sp|P07920|ACCO2_SOLLC 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Solanum lycopersicum GN=ACO2 PE=2 SV=1 25 242 3.0E-06
sp|P54847|ACCO3_CUCME 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Cucumis melo GN=ACO3 PE=2 SV=1 25 242 3.0E-06
sp|A2Z1W9|ACCO1_ORYSI 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. indica GN=ACO1 PE=2 SV=1 26 242 4.0E-06
sp|Q96330|FLS1_ARATH Flavonol synthase/flavanone 3-hydroxylase OS=Arabidopsis thaliana GN=FLS1 PE=1 SV=1 26 242 6.0E-06
sp|Q0J1C1|ACCO1_ORYSJ 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Oryza sativa subsp. japonica GN=ACO1 PE=2 SV=1 26 242 6.0E-06
sp|O48882|ACCO2_MALDO 1-aminocyclopropane-1-carboxylate oxidase 2 OS=Malus domestica GN=ACO2 PE=2 SV=1 24 242 6.0E-06
sp|Q04644|ACCO1_CUCME 1-aminocyclopropane-1-carboxylate oxidase 1 OS=Cucumis melo GN=ACO1 PE=2 SV=1 24 242 7.0E-06
sp|O65378|ACCO3_ARATH 1-aminocyclopropane-1-carboxylate oxidase 3 OS=Arabidopsis thaliana GN=At1g12010 PE=2 SV=1 26 242 7.0E-06
sp|Q9FFQ5|FLS3_ARATH Flavonol synthase 3 OS=Arabidopsis thaliana GN=FLS3 PE=2 SV=1 18 242 8.0E-06
sp|F4KAS1|FLS4_ARATH Probable flavonol synthase 4 OS=Arabidopsis thaliana GN=FLS4 PE=2 SV=1 25 242 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|119120
MSTQIPRVPPYIPAPPTNVNLEYADLPIIDLSKAKTAEGRKLLAKEVVDAMTNQGFFYVINHGYTSEQTKRMFDI
ANVPFEHVSESEKQDYLAAIKANGSFQGYKPREYFVEHYSINRDVNKRKHPQILRPLLPEIEAFAKRNHFNVLHP
ILRLLALGLELPEETFVDMHRFEAVGESYVRLVKYADDEEKSKNVWLKGHTDVGTITLLYSQPVSALQVLTSDGR
WKWVKHIDNAMVVNAGDGGDDPSTLYLQISDSSIRCRVVQPPRDQQGYPRVGLFYFAMADDNVRLEPVSQSPVLQ
RVGIKRRFDEDKTPTMEEWRKARTAAYGQTVLQKVGKIEEERIGNGIIRHYN*
Coding >Agabi119p4|119120
ATGAGCACGCAAATTCCTAGAGTCCCGCCATACATACCTGCTCCCCCTACCAACGTGAACTTGGAGTACGCTGAC
CTTCCTATTATTGACTTGTCCAAGGCCAAGACAGCGGAGGGGCGGAAGCTGCTCGCCAAAGAAGTCGTGGATGCC
ATGACCAACCAGGGATTCTTCTACGTCATCAATCATGGTTACACATCGGAGCAGACAAAACGGATGTTTGATATC
GCTAACGTCCCTTTCGAACATGTCAGTGAAAGCGAGAAACAAGACTATCTTGCCGCTATCAAGGCCAATGGATCG
TTTCAAGGTTACAAACCACGAGAATATTTTGTCGAACATTATAGCATCAATCGGGACGTGAACAAGCGGAAACAC
CCTCAAATTCTTCGACCGCTCCTTCCAGAGATCGAGGCGTTTGCAAAACGCAACCATTTCAATGTCTTGCATCCA
ATTCTAAGACTCCTTGCGTTAGGTCTGGAACTTCCAGAAGAAACTTTCGTTGACATGCATAGATTCGAAGCTGTT
GGTGAATCATACGTTCGCCTCGTGAAATATGCAGACGACGAGGAGAAGTCCAAAAATGTCTGGCTCAAGGGGCAT
ACAGATGTCGGAACCATTACACTTCTCTATAGTCAGCCGGTCTCGGCCCTCCAAGTGTTGACCTCAGATGGTCGT
TGGAAGTGGGTCAAGCACATTGACAATGCTATGGTTGTCAATGCTGGTGACGGTGGAGATGATCCCTCTACGTTA
TACTTGCAAATTTCTGATTCGTCAATACGTTGCAGAGTCGTTCAACCTCCGCGAGATCAACAGGGATATCCGCGC
GTGGGATTGTTTTATTTCGCCATGGCGGATGATAACGTGAGGCTTGAACCTGTCTCACAGAGCCCTGTCCTCCAG
CGTGTCGGGATAAAACGCCGCTTTGATGAGGATAAGACGCCGACAATGGAAGAGTGGCGAAAGGCGCGAACTGCA
GCGTATGGTCAAACTGTCTTGCAGAAAGTCGGGAAAATTGAAGAAGAGCGTATTGGTAATGGCATAATCAGACAC
TATAACTGA
Transcript >Agabi119p4|119120
ATGAGCACGCAAATTCCTAGAGTCCCGCCATACATACCTGCTCCCCCTACCAACGTGAACTTGGAGTACGCTGAC
CTTCCTATTATTGACTTGTCCAAGGCCAAGACAGCGGAGGGGCGGAAGCTGCTCGCCAAAGAAGTCGTGGATGCC
ATGACCAACCAGGGATTCTTCTACGTCATCAATCATGGTTACACATCGGAGCAGACAAAACGGATGTTTGATATC
GCTAACGTCCCTTTCGAACATGTCAGTGAAAGCGAGAAACAAGACTATCTTGCCGCTATCAAGGCCAATGGATCG
TTTCAAGGTTACAAACCACGAGAATATTTTGTCGAACATTATAGCATCAATCGGGACGTGAACAAGCGGAAACAC
CCTCAAATTCTTCGACCGCTCCTTCCAGAGATCGAGGCGTTTGCAAAACGCAACCATTTCAATGTCTTGCATCCA
ATTCTAAGACTCCTTGCGTTAGGTCTGGAACTTCCAGAAGAAACTTTCGTTGACATGCATAGATTCGAAGCTGTT
GGTGAATCATACGTTCGCCTCGTGAAATATGCAGACGACGAGGAGAAGTCCAAAAATGTCTGGCTCAAGGGGCAT
ACAGATGTCGGAACCATTACACTTCTCTATAGTCAGCCGGTCTCGGCCCTCCAAGTGTTGACCTCAGATGGTCGT
TGGAAGTGGGTCAAGCACATTGACAATGCTATGGTTGTCAATGCTGGTGACGGTGGAGATGATCCCTCTACGTTA
TACTTGCAAATTTCTGATTCGTCAATACGTTGCAGAGTCGTTCAACCTCCGCGAGATCAACAGGGATATCCGCGC
GTGGGATTGTTTTATTTCGCCATGGCGGATGATAACGTGAGGCTTGAACCTGTCTCACAGAGCCCTGTCCTCCAG
CGTGTCGGGATAAAACGCCGCTTTGATGAGGATAAGACGCCGACAATGGAAGAGTGGCGAAAGGCGCGAACTGCA
GCGTATGGTCAAACTGTCTTGCAGAAAGTCGGGAAAATTGAAGAAGAGCGTATTGGTAATGGCATAATCAGACAC
TATAACTGA
Gene >Agabi119p4|119120
ATGAGCACGCAAATTCCTAGAGTCCCGCCATACATACCTGCTCCCCCTACCAACGTGAACTGTAAGAGTCAAATT
CTAATTGGCTTACAACGCACTCAGGCTGACAATACTATATGCAGTGGAGTACGCTGACCTTCCTATTATTGACTT
GTCCAAGGCCAAGACAGCGGAGGGGCGGAAGCTGCTCGCCAAAGAAGTCGTGGATGCCATGACCAACCAGGGATT
CTTCTACGTCATCAATCATGGTTACACATCGGAGCAGGTACTTTGCAAGATATTCTCTAAAACAACTTGACTCGT
TACTCATGGAGTATCCAGACAAAACGGATGTTTGATATCGCTAACGTCCCTTTCGAACATGTCAGTGAAAGCGAG
AAACAAGACTATCTTGCCGCTATCAAGGCCAATGGATCGTTTCAAGGTTACAAACCACGAGAATATTTTGTATGT
CCACACATTGTAGTTCCTCGCGTTCAGCTTTTCACCCTGATCTGAACACCATATCGATAACGGAGTTCGTGATCA
GGTCGAACATTATAGCAGTAAGCTACTTCGCTGTCTTCTCAAGACTCTGTTTTCATGGATCCGAAGTCAATCGGG
ACGTGAACAAGCGGAAACACCCTCAAATTCTTCGACCGCTCCTTCCAGAGATCGAGGCGTTTGCAAAACGCAACC
ATTTCAATGTCTTGCATCCAATTCTAAGGTCATTGACCTCGCATCCAATCGAGTTAAGTTACTGCGTGACTAACC
AGACGAACTAGACTCCTTGCGTTAGGTCTGGAACTTCCAGAAGAAACTTTCGTTGACATGCATAGATTCGAAGCT
GTTGGTGAATCATACGGTATCTGAATTTTACTTTCTTCATAGGGAGAAGGGTTATTAAGAACATTCTCATTCAGT
TCGCCTCGTGAAATAGTGGGTCATGCTTACACTAAGCTCAGAAACTTGATGAAGCTATCCGAGAAGTGCAGACGA
CGAGGAGAAGTCCAAAAATGTCTGGCTCAAGGGGCATACAGGTGACCGAAAATTGTCCTCTAACCTCAATCTAAA
TTCTCTAAATTCTGGGTTGAGTCAGATGTCGGAACCATTACACTTCTCTATAGTCAGCCGGTCTCGGCCCTCCAA
GTGTTGACCTCAGATGGTCGTTGGAAGTGGGTCAAGCACATTGACAATGCTATGGTACGTTTTATGGATCTTGTT
TAGCCTATATTCAAATTCAAAGGTTGTCAATGCTGGTGACGGTATGGAATCCCTCTCCGGTGGCCATTATCGCGC
AACGATTCACAGGTGGAGATGATCCCTCTACGTTATACTTGCAAATTTCTGATTCGTCAATACGTTGCAGAGTCG
TTCAACCTCCGCGAGATCAACAGGGATATCCGCGCGTGGGATTGTTTTATTTCGCCATGGCGGATGATAACGTGA
GGCTTGAACCTGTCTCACAGAGCCCTGTCCTCCAGCGTGTCGGGATAAAACGCCGCTTTGATGAGGATAAGACGC
CGACAATGGAAGAGTGGCGAAAGGCGCGAACTGCAGCGTATGGTCAAACTGTCTTGCAGAAAGTCGGGAAAATTG
AAGAAGAGCGTATTGGTAATGGCATAATCAGACACTATAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail