Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|117170
Gene name
Locationscaffold_09:1081005..1082911
Strand-
Gene length (bp)1906
Transcript length (bp)1161
Coding sequence length (bp)1161
Protein length (aa) 387

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28 2.3E-43 46 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2EQQ2|RGXA_ASPNG Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger GN=rgxA PE=2 SV=1 2 382 8.0E-62
sp|A2QBB4|RGXA_ASPNC Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxA PE=2 SV=2 2 376 1.0E-61
sp|Q00293|PGLRX_ASPTU Exopolygalacturonase X OS=Aspergillus tubingensis GN=pgaX PE=1 SV=1 2 375 4.0E-57
sp|Q27UB3|PGLRX_ASPNG Exopolygalacturonase X OS=Aspergillus niger GN=pgaX PE=3 SV=1 2 375 2.0E-56
sp|A2R060|PGLRX_ASPNC Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaX PE=3 SV=1 2 375 2.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2EQQ2|RGXA_ASPNG Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger GN=rgxA PE=2 SV=1 2 382 8.0E-62
sp|A2QBB4|RGXA_ASPNC Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxA PE=2 SV=2 2 376 1.0E-61
sp|Q00293|PGLRX_ASPTU Exopolygalacturonase X OS=Aspergillus tubingensis GN=pgaX PE=1 SV=1 2 375 4.0E-57
sp|Q27UB3|PGLRX_ASPNG Exopolygalacturonase X OS=Aspergillus niger GN=pgaX PE=3 SV=1 2 375 2.0E-56
sp|A2R060|PGLRX_ASPNC Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaX PE=3 SV=1 2 375 2.0E-56
sp|A2RAY7|RGXC_ASPNC Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxC PE=2 SV=1 2 367 6.0E-56
sp|A1DLC1|PGLRX_NEOFI Probable exopolygalacturonase X OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaX PE=3 SV=2 2 375 8.0E-56
sp|Q4WCZ8|PGLRX_ASPFU Probable exopolygalacturonase X OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaX PE=3 SV=2 2 375 1.0E-55
sp|B0YDE8|PGLRX_ASPFC Probable exopolygalacturonase X OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaX PE=3 SV=2 2 375 1.0E-55
sp|Q2UP32|RGXA_ASPOR Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rgxA PE=3 SV=1 2 375 2.0E-54
sp|B8NJB0|RGXA_ASPFN Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rgxA PE=3 SV=2 2 375 2.0E-54
sp|Q00359|PGLRX_COCCA Exopolygalacturonase OS=Cochliobolus carbonum GN=PGX1 PE=3 SV=1 2 378 4.0E-52
sp|Q5ASG9|PGLX1_EMENI Exopolygalacturonase X-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-1 PE=1 SV=1 2 377 3.0E-51
sp|Q0CGP0|PGLRX_ASPTN Probable exopolygalacturonase X OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgaX PE=3 SV=1 2 374 8.0E-51
sp|B8NG16|PGLRX_ASPFN Probable exopolygalacturonase X OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaX PE=3 SV=1 2 375 2.0E-50
sp|A2QG68|RGXB_ASPNC Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxB PE=2 SV=2 1 374 4.0E-48
sp|Q5ARN5|PGLX2_EMENI Exopolygalacturonase X-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-2 PE=2 SV=1 2 373 5.0E-45
sp|A1D415|RGXC_NEOFI Putative galacturan 1,4-alpha-galacturonidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rgxC PE=3 SV=1 2 356 3.0E-44
sp|Q2TW03|PGXB_ASPOR Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgxB PE=3 SV=2 2 386 5.0E-41
sp|B8NX60|PGXB_ASPFN Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgxB PE=3 SV=1 2 386 9.0E-41
sp|Q0C7H7|PGXB_ASPTN Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgxB PE=3 SV=1 2 373 2.0E-38
sp|Q873X6|PGXB_EMENI Probable exopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgxB PE=2 SV=1 2 366 7.0E-38
sp|Q27UB2|PGXA_ASPNG Exopolygalacturonase A OS=Aspergillus niger GN=pgxA PE=3 SV=1 7 374 1.0E-35
sp|A2QW66|PGXA_ASPNC Probable exopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxA PE=3 SV=1 7 374 1.0E-35
sp|A1DAX2|PGXB_NEOFI Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgxB PE=3 SV=1 1 371 4.0E-35
sp|B0YAA4|PGXB_ASPFC Probable exopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgxB PE=3 SV=2 11 371 9.0E-35
sp|Q4WBK6|PGXB_ASPFU Probable exopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgxB PE=3 SV=2 11 371 1.0E-34
sp|Q27UB1|PGXB_ASPNG Exopolygalacturonase B OS=Aspergillus niger GN=pgxB PE=3 SV=1 16 376 1.0E-34
sp|A2QHG0|PGXB_ASPNC Probable exopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxB PE=3 SV=1 16 376 1.0E-34
sp|A2QK83|XGHA_ASPNC Probable endo-xylogalacturonan hydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xghA PE=3 SV=1 2 374 3.0E-32
sp|I1BYN6|RPG16_RHIO9 Exopolygalacturonase rpg16 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg16 PE=1 SV=1 2 374 3.0E-32
sp|Q9UUZ2|XGHA_ASPTU Endo-xylogalacturonan hydrolase A OS=Aspergillus tubingensis GN=xghA PE=1 SV=1 2 374 1.0E-31
sp|B0Y9F8|XGHA_ASPFC Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xghA PE=3 SV=2 1 374 4.0E-31
sp|Q4WBT4|XGHA_ASPFU Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xghA PE=3 SV=2 1 374 2.0E-30
sp|A1DBT5|XGHA_NEOFI Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xghA PE=3 SV=1 1 374 6.0E-30
sp|B8NPS8|XGHA_ASPFN Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xghA PE=3 SV=1 2 374 4.0E-28
sp|Q2UBD8|XGHA_ASPOR Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xghA PE=3 SV=1 2 374 3.0E-27
sp|P48978|PGLR_MALDO Polygalacturonase OS=Malus domestica PE=2 SV=1 89 363 2.0E-26
sp|Q94AJ5|PGLR5_ARATH Probable polygalacturonase At1g80170 OS=Arabidopsis thaliana GN=At1g80170 PE=1 SV=1 88 376 2.0E-25
sp|I1BYM7|RPG15_RHIO9 Exopolygalacturonase rpg15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg15 PE=1 SV=1 2 372 2.0E-25
sp|Q02096|PGLR_PERAE Polygalacturonase OS=Persea americana PE=2 SV=1 2 361 5.0E-24
sp|O23147|ADPG1_ARATH Polygalacturonase ADPG1 OS=Arabidopsis thaliana GN=ADPG1 PE=2 SV=1 70 376 6.0E-24
sp|P35336|PGLR_ACTDE Polygalacturonase OS=Actinidia deliciosa PE=2 SV=1 88 374 2.0E-23
sp|Q9FY19|PGLR2_JUNAS Polygalacturonase OS=Juniperus ashei GN=JNA2 PE=1 SV=1 2 358 2.0E-23
sp|Q7M1E7|PGLR2_CHAOB Polygalacturonase OS=Chamaecyparis obtusa PE=1 SV=1 41 362 2.0E-21
sp|Q9SFB7|QRT2_ARATH Polygalacturonase QRT2 OS=Arabidopsis thaliana GN=QRT2 PE=1 SV=2 88 361 4.0E-21
sp|Q949Z1|PGLR4_ARATH Polygalacturonase At1g48100 OS=Arabidopsis thaliana GN=At1g48100 PE=2 SV=1 23 376 4.0E-21
sp|Q5B7U1|XGHA_EMENI Probable endo-xylogalacturonan hydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xghA PE=3 SV=1 1 366 6.0E-21
sp|P05117|PGLR_SOLLC Polygalacturonase-2 OS=Solanum lycopersicum GN=PG2 PE=1 SV=1 98 376 1.0E-19
sp|Q6H9K0|PGLR2_PLAAC Exopolygalacturonase (Fragment) OS=Platanus acerifolia GN=plaa2 PE=1 SV=1 83 374 1.0E-19
sp|P49062|PGLR1_ARATH Exopolygalacturonase clone GBGE184 OS=Arabidopsis thaliana GN=PGA3 PE=2 SV=1 89 385 1.0E-19
sp|P43212|PGLR2_CRYJA Polygalacturonase OS=Cryptomeria japonica PE=1 SV=1 89 362 4.0E-19
sp|P35339|PGLR3_MAIZE Exopolygalacturonase OS=Zea mays GN=PG2C PE=2 SV=1 2 362 4.0E-19
sp|P26216|PGLR1_MAIZE Exopolygalacturonase OS=Zea mays GN=PG1 PE=1 SV=1 2 362 7.0E-19
sp|Q9LW07|PGLR3_ARATH Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana GN=At3g15720 PE=1 SV=1 75 362 1.0E-18
sp|P35338|PGLR2_MAIZE Exopolygalacturonase OS=Zea mays GN=PG9 PE=2 SV=1 2 362 2.0E-18
sp|Q8RY29|ADPG2_ARATH Polygalacturonase ADPG2 OS=Arabidopsis thaliana GN=ADPG2 PE=2 SV=2 73 378 3.0E-18
sp|P49063|PGLR2_ARATH Exopolygalacturonase clone GBGA483 OS=Arabidopsis thaliana GN=At3g07850 PE=2 SV=2 174 378 4.0E-18
sp|I1BYN5|RPG14_RHIO9 Exopolygalacturonase rpg14 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg14 PE=1 SV=1 2 374 2.0E-17
sp|Q4WX94|PGXC_ASPFU Probable exopolygalacturonase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgxC PE=3 SV=1 2 354 4.0E-17
sp|B0XYC4|PGXC_ASPFC Probable exopolygalacturonase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgxC PE=3 SV=1 2 354 5.0E-17
sp|Q9P4W2|PGLRD_ASPNG Endopolygalacturonase D OS=Aspergillus niger GN=pgaD PE=3 SV=1 76 361 5.0E-17
sp|A2QTU0|PGLRD_ASPNC Probable endopolygalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaD PE=3 SV=1 76 361 5.0E-17
sp|P24548|PGLR_OENOR Exopolygalacturonase (Fragment) OS=Oenothera organensis PE=2 SV=1 122 374 9.0E-17
sp|A1D7I1|PGXC_NEOFI Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgxC PE=3 SV=1 2 336 1.0E-15
sp|P35337|PGLR_BRANA Polygalacturonase OS=Brassica napus PE=2 SV=1 88 374 1.0E-15
sp|Q5AYH4|PGLRD_EMENI Probable endopolygalacturonase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaD PE=3 SV=1 76 361 2.0E-15
sp|I1BPS7|RPG13_RHIO9 Exopolygalacturonase rpg13 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg13 PE=1 SV=1 2 374 3.0E-15
sp|Q07181|PGLR_GIBFU Polygalacturonase OS=Gibberella fujikuroi GN=PGA PE=1 SV=1 27 338 4.0E-15
sp|A1DBR6|PGLRD_NEOFI Probable endopolygalacturonase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaD PE=3 SV=1 76 366 1.0E-14
sp|Q39766|PGLR_GOSBA Polygalacturonase OS=Gossypium barbadense GN=G9 PE=2 SV=1 117 363 1.0E-14
sp|Q39786|PGLR_GOSHI Polygalacturonase OS=Gossypium hirsutum GN=G9 PE=2 SV=1 117 363 2.0E-14
sp|Q9Y833|PGLR2_PENOL Polygalacturonase 2 OS=Penicillium olsonii GN=PG2 PE=3 SV=1 78 374 3.0E-14
sp|O59925|PGLR_PENEN Polygalacturonase OS=Penicillium expansum GN=PEPG1 PE=3 SV=1 12 375 9.0E-14
sp|O22818|PGLR6_ARATH Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana GN=At2g43860 PE=2 SV=1 175 375 9.0E-14
sp|Q40312|PGLR_MEDSA Polygalacturonase OS=Medicago sativa PE=2 SV=1 125 362 3.0E-13
sp|Q27UB0|PGXC_ASPNG Exopolygalacturonase C OS=Aspergillus niger GN=pgxC PE=2 SV=1 2 373 9.0E-13
sp|A2QEW2|PGXC_ASPNC Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxC PE=3 SV=2 2 373 9.0E-13
sp|A2QL39|PGLRC_ASPNC Probable endopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaC PE=3 SV=1 78 371 1.0E-12
sp|Q12554|PGLRC_ASPNG Probable endopolygalacturonase C OS=Aspergillus niger GN=pgaC PE=3 SV=1 78 371 1.0E-12
sp|P48979|PGLR_PRUPE Polygalacturonase OS=Prunus persica PE=2 SV=1 90 375 4.0E-12
sp|Q9Y834|PGLR1_PENOL Polygalacturonase 1 OS=Penicillium olsonii GN=PG1 PE=3 SV=1 79 374 6.0E-12
sp|Q9P4W3|PGLRB_ASPNG Endopolygalacturonase B OS=Aspergillus niger GN=pgaB PE=1 SV=1 78 374 8.0E-12
sp|A2QCV8|PGLRB_ASPNC Probable endopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaB PE=3 SV=1 78 374 8.0E-12
sp|O42824|PGLR_PENJA Polygalacturonase OS=Penicillium janthinellum PE=3 SV=1 78 374 9.0E-12
sp|Q8NK99|PGLRA_ASPKW Probable endopolygalacturonase A OS=Aspergillus kawachii (strain NBRC 4308) GN=pgaA PE=3 SV=1 78 374 1.0E-11
sp|Q9P359|PGLR2_ASPAW Endopolygalacturonase II OS=Aspergillus awamori GN=pgaII PE=1 SV=1 78 379 2.0E-11
sp|Q70HJ3|PGLRC_ASPAC Probable endopolygalacturonase C OS=Aspergillus aculeatus GN=pgaC PE=2 SV=1 78 345 2.0E-11
sp|Q0CMU3|PGLR1_ASPTN Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgaI PE=3 SV=1 78 374 2.0E-11
sp|Q9P4W4|PGLRA_ASPNG Endopolygalacturonase A OS=Aspergillus niger GN=pgaA PE=1 SV=1 78 374 2.0E-11
sp|A2R8F8|PGLRA_ASPNC Probable endopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaA PE=3 SV=1 78 374 2.0E-11
sp|B8MW78|PGLRD_ASPFN Probable endopolygalacturonase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaD PE=3 SV=1 76 366 2.0E-11
sp|Q5B508|PGLRB_EMENI Endopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaB PE=1 SV=2 78 374 2.0E-11
sp|Q2UT29|PGLRD_ASPOR Probable endopolygalacturonase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaD PE=3 SV=2 76 366 2.0E-11
sp|Q8NK98|PGLR2_ASPKW Probable endopolygalacturonase II OS=Aspergillus kawachii (strain NBRC 4308) GN=pgaII PE=3 SV=2 78 374 2.0E-11
sp|Q1HAY5|PGLRB_ASPKA Probable endopolygalacturonase B OS=Aspergillus kawachii GN=pgaB PE=3 SV=1 78 374 4.0E-11
sp|P49575|PGLRA_ASPPA Probable endopolygalacturonase A OS=Aspergillus parasiticus GN=pgaA PE=2 SV=1 78 374 7.0E-11
sp|P19805|PGLR2_ASPTU Endopolygalacturonase II OS=Aspergillus tubingensis GN=pgaII PE=1 SV=1 78 374 8.0E-11
sp|P26213|PGLR1_ASPNG Endopolygalacturonase I OS=Aspergillus niger GN=pgaI PE=1 SV=1 80 374 1.0E-10
sp|A2QAH3|PGLR1_ASPNC Probable endopolygalacturonase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaI PE=3 SV=1 80 374 1.0E-10
sp|Q9P358|PGLRA_ASPAW Endopolygalacturonase A OS=Aspergillus awamori GN=pgaA PE=1 SV=1 78 374 1.0E-10
sp|P26215|PGLR_COCCA Polygalacturonase OS=Cochliobolus carbonum GN=PGN1 PE=3 SV=1 78 347 2.0E-10
sp|Q05967|PGLR_TOBAC Polygalacturonase OS=Nicotiana tabacum GN=PG1 PE=2 SV=1 89 384 2.0E-10
sp|O42809|PGLRE_ASPNG Endopolygalacturonase E OS=Aspergillus niger GN=pgaE PE=1 SV=1 78 374 3.0E-10
sp|P26214|PGLR2_ASPNG Endopolygalacturonase II OS=Aspergillus niger GN=pgaII PE=1 SV=1 78 374 3.0E-10
sp|A2R5S4|PGLR2_ASPNC Probable endopolygalacturonase II OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaII PE=3 SV=1 78 374 3.0E-10
sp|B8N7Z8|PGLRB_ASPFN Probable endopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaB PE=3 SV=1 78 374 4.0E-10
sp|P35335|PGLRB_ASPOR Endopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaB PE=2 SV=2 78 374 5.0E-10
sp|Q5ATQ3|PGLR_EMENI Endopolygalacturonase AN8327 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN8327 PE=1 SV=1 78 379 6.0E-10
sp|P41749|PGLRA_ASPFL Endopolygalacturonase A OS=Aspergillus flavus GN=pgaA PE=2 SV=1 78 374 7.0E-10
sp|A2QBB6|PGLRE_ASPNC Probable endopolygalacturonase E OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaE PE=3 SV=1 78 374 8.0E-10
sp|Q2UHL4|PGLR1_ASPOR Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaI PE=1 SV=1 93 374 1.0E-09
sp|B8N8M2|PGLR1_ASPFN Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaI PE=3 SV=1 93 374 1.0E-09
sp|Q4WQT2|PGLRA_ASPFU Probable endopolygalacturonase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaA PE=3 SV=1 80 374 1.0E-09
sp|B0Y4Z4|PGLRA_ASPFC Probable endopolygalacturonase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaA PE=3 SV=1 80 374 1.0E-09
sp|Q5ARE6|RHGA_EMENI Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhgA PE=2 SV=2 177 375 2.0E-09
sp|Q70HJ4|PGLR2_ASPAC Probable endopolygalacturonase II OS=Aspergillus aculeatus GN=pgaII PE=2 SV=1 80 374 2.0E-09
sp|A1CVV8|PGLRA_NEOFI Probable endopolygalacturonase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaA PE=3 SV=1 80 374 2.0E-09
sp|Q1ZZM3|RHGE_ASPNG Probable rhamnogalacturonase E OS=Aspergillus niger GN=rhgE PE=3 SV=1 70 376 2.0E-09
sp|Q9Y718|PGLR_PENDI Polygalacturonase OS=Penicillium digitatum GN=PG1 PE=3 SV=1 79 345 3.0E-09
sp|Q4WBE1|PGLRB_ASPFU Probable endopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaB PE=3 SV=1 78 345 4.0E-09
sp|B0YAH0|PGLRB_ASPFC Probable endopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaB PE=3 SV=1 78 345 5.0E-09
sp|P87160|RHGA_ASPNG Rhamnogalacturonase A OS=Aspergillus niger GN=rhgA PE=1 SV=1 111 376 6.0E-09
sp|O93883|PGLR_PENGR Polygalacturonase OS=Penicillium griseoroseum GN=PGG1 PE=3 SV=1 13 353 8.0E-09
sp|A1DAQ2|PGLRB_NEOFI Probable endopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaB PE=3 SV=1 78 345 8.0E-09
sp|Q2UFD2|RHGC_ASPOR Probable rhamnogalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rhgC PE=3 SV=1 45 376 1.0E-08
sp|A2QYE5|RHGA_ASPNC Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rhgA PE=3 SV=1 177 376 1.0E-08
sp|Q00446|PGLR1_COLLN Endopolygalacturonase 1 OS=Colletotrichum lindemuthianum GN=PG1 PE=3 SV=1 79 262 3.0E-08
sp|O74213|PGLR1_ASPAC Endopolygalacturonase I OS=Aspergillus aculeatus GN=pgaI PE=1 SV=1 78 374 3.0E-08
sp|Q12708|PGLR1_SCLSC Endo-polygalacturonase OS=Sclerotinia sclerotiorum GN=PG1 PE=3 SV=1 78 350 5.0E-08
sp|B8NGP8|RHGC_ASPFN Probable rhamnogalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rhgC PE=3 SV=2 45 376 1.0E-07
sp|P47180|PGLR_YEAST Polygalacturonase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGU1 PE=1 SV=1 78 338 3.0E-07
sp|Q2U293|RHGA_ASPOR Probable rhamnogalacturonase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rhgA PE=3 SV=1 177 374 3.0E-07
sp|B8NK45|RHGA_ASPFN Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rhgA PE=3 SV=1 177 374 3.0E-07
sp|B0Y0Q3|RHGB_ASPFC Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rhgB PE=3 SV=1 177 376 7.0E-07
sp|Q4WV23|RHGB_ASPFU Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rhgB PE=3 SV=1 177 376 7.0E-07
sp|P41750|PGLRB_ASPFL Endopolygalacturonase B OS=Aspergillus flavus GN=pgaB PE=2 SV=1 80 374 9.0E-07
sp|Q00001|RHGA_ASPAC Rhamnogalacturonase A OS=Aspergillus aculeatus GN=rhgA PE=1 SV=1 177 376 1.0E-06
sp|P87161|RHGB_ASPNG Rhamnogalacturonase B OS=Aspergillus niger GN=rhgB PE=1 SV=1 177 376 3.0E-06
sp|A2QLQ5|RHGC_ASPNC Probable rhamnogalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rhgC PE=3 SV=1 122 376 4.0E-06
sp|A1D145|PGLR_NEOFI Probable endopolygalacturonase NFIA_008150 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_008150 PE=3 SV=1 78 379 6.0E-06
sp|A1DED1|RHGB_NEOFI Probable rhamnogalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rhgB PE=3 SV=1 177 376 6.0E-06
sp|B8NKB9|RHGE_ASPFN Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rhgE PE=3 SV=2 194 375 8.0E-06
sp|A2QWT2|RHGD_ASPNC Putative rhamnogalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rhgD PE=3 SV=1 189 356 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004650 polygalacturonase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|117170
MDDTDQVEAAINACGHSGTITFEKGMFNITRRMMWDLDNAHVDLKGTLSFQPDTDYWLNKSNTFQVVFIQSQSSW
FVVTGKNFVIDGHGAGGINGNGQAWWNLFATTRPRLDGDGRPIAFTLWRVSNAVIRGFNVQSPPFWAHTVAESAD
VLYENILVNATNTDPTFSGQNIVWNTDGINTYRSSRITMRNWDVTGGDDCIAIKGNSTRITARNFICRGGEGVAF
GSLGQYANMTDLVSDILIENVQVLRLPSDVQPNNVHGIYFKTWDGSLNNGEPPTGGGGGSGLVKNAVFRNFKLDR
VDTAVQIIQDFGGGGVIGSRVKLQDMRFENIRGTTNDSTIINLACSQAVGCSDLVFKNFNVRNPKGADEYICENA
HHISGLKGEFS*
Coding >Agabi119p4|117170
ATGGACGATACTGATCAGGTTGAAGCCGCTATCAACGCATGCGGACATTCTGGGACTATCACCTTTGAAAAAGGA
ATGTTCAACATCACCAGGAGGATGATGTGGGACCTTGATAATGCGCATGTTGACCTCAAGGGGACATTGAGTTTC
CAACCTGATACAGATTACTGGCTTAACAAGAGCAACACATTCCAAGTCGTTTTCATTCAGAGTCAATCCTCGTGG
TTTGTTGTAACAGGCAAGAATTTTGTGATCGATGGACACGGTGCTGGAGGTATAAATGGAAATGGCCAGGCTTGG
TGGAACCTTTTTGCAACTACACGTCCCCGACTCGACGGCGATGGCCGACCTATTGCATTCACTCTGTGGAGAGTC
AGTAATGCAGTGATCCGCGGGTTCAATGTTCAAAGTCCTCCGTTTTGGGCACACACGGTTGCTGAATCCGCGGAT
GTTTTGTACGAGAATATCCTGGTCAATGCCACCAATACTGACCCAACTTTCTCTGGCCAAAATATCGTATGGAAT
ACCGACGGCATCAACACTTACAGAAGTTCTCGCATAACGATGCGTAACTGGGATGTTACCGGTGGAGACGATTGC
ATTGCGATCAAGGGCAATTCCACTAGGATAACAGCCCGAAACTTTATTTGTCGTGGGGGCGAAGGCGTTGCTTTT
GGATCTTTGGGCCAATACGCCAACATGACAGATCTAGTTTCTGATATTCTTATTGAGAACGTGCAGGTGCTGCGT
CTTCCCTCCGACGTACAGCCGAACAATGTACATGGTATTTACTTCAAAACTTGGGATGGGTCTCTGAACAACGGC
GAACCACCGACCGGAGGAGGCGGAGGCTCAGGACTTGTAAAGAATGCTGTTTTCCGGAATTTCAAGTTGGATCGG
GTCGACACTGCTGTTCAAATCATACAAGATTTTGGAGGCGGCGGAGTCATCGGCTCCCGTGTCAAACTCCAGGAT
ATGCGGTTTGAGAATATTAGGGGCACTACAAACGACTCTACAATCATAAATCTCGCGTGTAGTCAAGCAGTTGGA
TGCTCTGACTTAGTTTTCAAGAACTTTAATGTTCGTAATCCAAAAGGCGCAGATGAGTACATCTGTGAAAATGCT
CACCATATATCGGGTTTAAAAGGCGAGTTTTCCTAA
Transcript >Agabi119p4|117170
ATGGACGATACTGATCAGGTTGAAGCCGCTATCAACGCATGCGGACATTCTGGGACTATCACCTTTGAAAAAGGA
ATGTTCAACATCACCAGGAGGATGATGTGGGACCTTGATAATGCGCATGTTGACCTCAAGGGGACATTGAGTTTC
CAACCTGATACAGATTACTGGCTTAACAAGAGCAACACATTCCAAGTCGTTTTCATTCAGAGTCAATCCTCGTGG
TTTGTTGTAACAGGCAAGAATTTTGTGATCGATGGACACGGTGCTGGAGGTATAAATGGAAATGGCCAGGCTTGG
TGGAACCTTTTTGCAACTACACGTCCCCGACTCGACGGCGATGGCCGACCTATTGCATTCACTCTGTGGAGAGTC
AGTAATGCAGTGATCCGCGGGTTCAATGTTCAAAGTCCTCCGTTTTGGGCACACACGGTTGCTGAATCCGCGGAT
GTTTTGTACGAGAATATCCTGGTCAATGCCACCAATACTGACCCAACTTTCTCTGGCCAAAATATCGTATGGAAT
ACCGACGGCATCAACACTTACAGAAGTTCTCGCATAACGATGCGTAACTGGGATGTTACCGGTGGAGACGATTGC
ATTGCGATCAAGGGCAATTCCACTAGGATAACAGCCCGAAACTTTATTTGTCGTGGGGGCGAAGGCGTTGCTTTT
GGATCTTTGGGCCAATACGCCAACATGACAGATCTAGTTTCTGATATTCTTATTGAGAACGTGCAGGTGCTGCGT
CTTCCCTCCGACGTACAGCCGAACAATGTACATGGTATTTACTTCAAAACTTGGGATGGGTCTCTGAACAACGGC
GAACCACCGACCGGAGGAGGCGGAGGCTCAGGACTTGTAAAGAATGCTGTTTTCCGGAATTTCAAGTTGGATCGG
GTCGACACTGCTGTTCAAATCATACAAGATTTTGGAGGCGGCGGAGTCATCGGCTCCCGTGTCAAACTCCAGGAT
ATGCGGTTTGAGAATATTAGGGGCACTACAAACGACTCTACAATCATAAATCTCGCGTGTAGTCAAGCAGTTGGA
TGCTCTGACTTAGTTTTCAAGAACTTTAATGTTCGTAATCCAAAAGGCGCAGATGAGTACATCTGTGAAAATGCT
CACCATATATCGGGTTTAAAAGGCGAGTTTTCCTAA
Gene >Agabi119p4|117170
ATGGACGATACTGATCAGGTAAATTTGTTCCAAAAATCAGTGCTTAATATGATTACGAGGAATTGTGTAGGTTGA
AGCCGCTATCAACGCATGCGGACATTCTGGGACTATCACCTTTGAAAAAGGAATGTTCAACATCACCAGGTTGGT
TCTGTGATCTGTCTGGGAGACTTATTTTCACGACATACTGTTATAAATTCTCACTTATTAAGGAGGATGATGTGG
GACCTTGATAATGCGCATGTTGACCTCAAGGGGACATTGAGTGTAAGTGCACGTATCTCGACTCAAACTTTCATA
ACTCAGTTCCTCCATCAGTTCCAACCTGATACAGATTACTGGCTTAACAAGAGCAACACATTCCAAGTCGTTTTC
ATTCAGGTCTGTTCAAGCTAGTTGACAAAATACAAGACTGATAAGGAAGTTTATAGAGTCAATCCTCGTGGTTTG
TTGTAACAGGCAAGAATTTTGTGATCGATGGACACGGTGCTGGAGGTATAAATGGAAATGGCCAGGTCGGGTGCA
CTCTTTTTTTTTGTGAATCTGGGTTTAATGGGCGGCATAGGCTTGGTGGAACCTTTTTGCAACTACACGTCCCCG
ACTCGACGGCGATGGCCGACCTATTGCATTCACTCTGTGGAGAGTCAGTAATGCAGTGATCCGCGGGTTCAATGT
TCAAAGTCCTCCGTTTTGGGCACACACGGTTGCTGAATCCGCGGATGTTTTGTACGAGAATATCCTGGTCAATGC
CACCAATACTGACCCAACTTTCTCTGGCCAAAAGTATGAAATACTGGTTTACTTTCCAACTCAATCAGAATTAAT
CCTCTTTACAGTATCGTATGGAATACCGACGGTGGGGTTTCAGAGTCGCTAAGACTGTACAGAGATATCGATTGC
CTGAACGTTTCTAGGCATCAACACTTACAGAAGTTCTCGCATAACGATGCGTAACTGGGATGTTACCGGTGGAGA
CGATTGCATTGCGATCAAGGGCGTAAGTTGCCTCATATATCTCCTTCCTATGCCACTCATTCATCGAAATGCGTC
AAGAATTCCACTAGGATAACAGCCCGAAACTTTATTTGTCGTGGGGGCGAAGGCGTTGCTTTTGGATCTTTGGGC
CAATACGCCAACATGGTGGGTCCTTGTCCAACTCGTCTTAGGGTACTCTGACACTCTCGATGTAGACAGATCTAG
TTTCTGATATTCTTATTGAGAACGTGCAGGTACAGTTGCAATTCCTAGCGCAGTGGTACGGCACAACTCAATTTA
ACTACCCTTATTAGGTGCTGCGTCTTCCCTCCGACGTACAGCCGAACAATGTACATGGTGTAAGTCGATCTGTTT
GAAGAGTAAACACATTGATGTATCCGCATCAGATTTACTTCAAAACTTGGGATGGGTCTCTGAACAACGGCGAAC
CACCGACCGGAGGAGGCGGAGGCTCAGGTAAGCATAGTATTCAAGATGAAACCGTTTTTATCGAAGTTATGATTA
GGACTTGTAAAGAATGCTGTTTTCCGGAATTTCAAGTTGGATCGGGTCGACACTGCTGTTCAAATCATACAAGAT
TTTGGAGGCGGGTCAGTATTTGAAATTTTAGTTTGCGCGAGTTTCGCTCATATTACCAAGCGGAGTCATCGGCTC
CCGTGTCAAACTCCAGGATATGCGGTTTGAGAATATTAGGGGCACTACAAACGACTCTACAAGTGCGACACGCTC
TTCATTAACTCTGGAGACTTTACTGATTACGTTTATAGTCATAAATCTCGCGTGTAGTCAAGCAGTTGGATGCTC
TGACTTAGTTTTCAAGAACTTTAATGTTCGTAATCCAAAAGGCGCAGATGAGTACATCTGTGAAAATGCTCACCA
TATATCGGGTTTAAAAGGCGAGTTTTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail