Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|116960
Gene name
Locationscaffold_09:1025813..1027078
Strand+
Gene length (bp)1265
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08231 SYF2 SYF2 splicing factor 2.3E-59 123 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BC69|SYF2_EMENI Pre-mRNA-splicing factor syf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=syf2 PE=3 SV=1 30 308 5.0E-40
sp|Q4WPM6|SYF2_ASPFU Pre-mRNA-splicing factor syf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=syf2 PE=3 SV=2 64 308 7.0E-40
sp|Q521C0|SYF2_MAGO7 Pre-mRNA-splicing factor SYF2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SYF2 PE=3 SV=2 56 308 2.0E-37
sp|Q7RZK5|SYF2_NEUCR Pre-mRNA-splicing factor syf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-4 PE=3 SV=1 73 308 2.0E-35
sp|Q6DGP2|SYF2_DANRE Pre-mRNA-splicing factor syf2 OS=Danio rerio GN=syf2 PE=2 SV=1 37 308 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BC69|SYF2_EMENI Pre-mRNA-splicing factor syf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=syf2 PE=3 SV=1 30 308 5.0E-40
sp|Q4WPM6|SYF2_ASPFU Pre-mRNA-splicing factor syf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=syf2 PE=3 SV=2 64 308 7.0E-40
sp|Q521C0|SYF2_MAGO7 Pre-mRNA-splicing factor SYF2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SYF2 PE=3 SV=2 56 308 2.0E-37
sp|Q7RZK5|SYF2_NEUCR Pre-mRNA-splicing factor syf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-4 PE=3 SV=1 73 308 2.0E-35
sp|Q6DGP2|SYF2_DANRE Pre-mRNA-splicing factor syf2 OS=Danio rerio GN=syf2 PE=2 SV=1 37 308 2.0E-32
sp|Q4QRB2|SYF2_RAT Pre-mRNA-splicing factor SYF2 OS=Rattus norvegicus GN=Syf2 PE=2 SV=1 79 308 2.0E-29
sp|Q9D198|SYF2_MOUSE Pre-mRNA-splicing factor SYF2 OS=Mus musculus GN=Syf2 PE=2 SV=1 79 308 2.0E-29
sp|O95926|SYF2_HUMAN Pre-mRNA-splicing factor SYF2 OS=Homo sapiens GN=SYF2 PE=1 SV=1 70 308 1.0E-28
sp|Q28G05|SYF2_XENTR Pre-mRNA-splicing factor syf2 OS=Xenopus tropicalis GN=syf2 PE=2 SV=1 61 308 1.0E-28
sp|Q6DV01|SYF2_GECJA Pre-mRNA-splicing factor syf2 OS=Gecko japonicus GN=syf2 PE=2 SV=1 78 308 6.0E-28
sp|O59733|SYF2_SCHPO Pre-mRNA-splicing factor syf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syf2 PE=1 SV=1 66 308 4.0E-26
sp|Q8AVQ6|SYF2_XENLA Pre-mRNA-splicing factor syf2 OS=Xenopus laevis GN=syf2 PE=2 SV=1 32 308 6.0E-25
sp|Q6BVE0|SYF2_DEBHA Pre-mRNA-splicing factor SYF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SYF2 PE=3 SV=2 37 292 1.0E-24
sp|Q6CFW4|SYF2_YARLI Pre-mRNA-splicing factor SYF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SYF2 PE=3 SV=1 77 308 3.0E-24
sp|Q612R3|SYF2_CAEBR Pre-mRNA-splicing factor syf-2 OS=Caenorhabditis briggsae GN=syf-2 PE=3 SV=2 63 308 1.0E-22
sp|Q9V5Q4|SYF2_DROME Pre-mRNA-splicing factor Syf2 OS=Drosophila melanogaster GN=Syf2 PE=2 SV=1 63 308 2.0E-21
sp|Q09385|SYF2_CAEEL Pre-mRNA-splicing factor syf-2 OS=Caenorhabditis elegans GN=syf-2 PE=3 SV=3 63 308 5.0E-20
sp|Q28XK6|SYF2_DROPS Pre-mRNA-splicing factor Syf2 OS=Drosophila pseudoobscura pseudoobscura GN=Syf2 PE=3 SV=1 63 308 3.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|116960
MDSMTTDKTESPARNADIVEAALDTTKDRSLDQAEDSSEETTTPETEGNGEGEESGEGRKVSMKDREAKLALLRK
RFHDSSKANRQSLIEESAKAKLNARELARLERQRALADMLRLKADAEERGEDVERFRNWEYTIEDNENWEKKLKR
KKRRADFEFHDASHATRRKYKRDLDLLEPDLEAYKRQKALATGGILNSFDASGSTNSSLVPTSSSVEQKIAHDNF
YRDSSTLIYADDKPSEDAIDRVVSKINKDIDKRGKFSRQRLNEPEGDVTYINEPNRVFNKKISRFYDKYTADIRA
SFERGTAL*
Coding >Agabi119p4|116960
ATGGACTCTATGACAACAGACAAAACTGAAAGTCCTGCACGAAATGCCGATATAGTAGAGGCTGCTCTGGATACT
ACCAAGGACAGGTCACTAGACCAGGCAGAGGACTCGTCAGAAGAGACAACAACACCTGAGACGGAGGGAAATGGT
GAAGGTGAAGAGAGCGGGGAGGGAAGGAAGGTGAGTATGAAAGATAGGGAAGCAAAGTTGGCTTTGTTACGAAAG
AGATTCCATGATTCTTCCAAAGCAAACAGACAATCTCTCATTGAGGAAAGTGCGAAAGCGAAATTGAATGCTAGA
GAACTTGCGCGGTTGGAAAGACAAAGAGCATTAGCGGATATGTTGAGGTTGAAGGCGGATGCGGAGGAAAGAGGG
GAGGATGTTGAGAGGTTTAGGAATTGGGAGTATACGATTGAGGATAATGAGAATTGGGAGAAAAAGTTGAAGAGG
AAGAAGAGGAGAGCGGATTTTGAGTTTCATGATGCAAGTCATGCTACTCGGCGCAAGTATAAACGAGATTTAGAT
CTTCTTGAACCGGATCTTGAAGCTTATAAACGACAAAAAGCACTTGCTACAGGTGGTATACTCAATTCCTTTGAC
GCAAGTGGCAGTACCAATTCGTCTCTTGTCCCAACATCGAGTTCGGTTGAACAAAAGATTGCTCATGATAACTTT
TATCGGGACAGTTCGACACTTATTTATGCTGATGATAAACCGAGCGAGGACGCTATTGATCGTGTCGTCAGTAAG
ATCAATAAAGATATCGACAAGCGGGGCAAATTTTCACGACAACGGCTTAACGAACCCGAAGGAGACGTTACTTAT
ATCAATGAACCAAATCGCGTGTTTAACAAGAAGATATCGAGATTCTATGACAAATATACGGCAGATATTCGTGCT
AGTTTCGAACGTGGTACAGCTTTGTAG
Transcript >Agabi119p4|116960
ATGGACTCTATGACAACAGACAAAACTGAAAGTCCTGCACGAAATGCCGATATAGTAGAGGCTGCTCTGGATACT
ACCAAGGACAGGTCACTAGACCAGGCAGAGGACTCGTCAGAAGAGACAACAACACCTGAGACGGAGGGAAATGGT
GAAGGTGAAGAGAGCGGGGAGGGAAGGAAGGTGAGTATGAAAGATAGGGAAGCAAAGTTGGCTTTGTTACGAAAG
AGATTCCATGATTCTTCCAAAGCAAACAGACAATCTCTCATTGAGGAAAGTGCGAAAGCGAAATTGAATGCTAGA
GAACTTGCGCGGTTGGAAAGACAAAGAGCATTAGCGGATATGTTGAGGTTGAAGGCGGATGCGGAGGAAAGAGGG
GAGGATGTTGAGAGGTTTAGGAATTGGGAGTATACGATTGAGGATAATGAGAATTGGGAGAAAAAGTTGAAGAGG
AAGAAGAGGAGAGCGGATTTTGAGTTTCATGATGCAAGTCATGCTACTCGGCGCAAGTATAAACGAGATTTAGAT
CTTCTTGAACCGGATCTTGAAGCTTATAAACGACAAAAAGCACTTGCTACAGGTGGTATACTCAATTCCTTTGAC
GCAAGTGGCAGTACCAATTCGTCTCTTGTCCCAACATCGAGTTCGGTTGAACAAAAGATTGCTCATGATAACTTT
TATCGGGACAGTTCGACACTTATTTATGCTGATGATAAACCGAGCGAGGACGCTATTGATCGTGTCGTCAGTAAG
ATCAATAAAGATATCGACAAGCGGGGCAAATTTTCACGACAACGGCTTAACGAACCCGAAGGAGACGTTACTTAT
ATCAATGAACCAAATCGCGTGTTTAACAAGAAGATATCGAGATTCTATGACAAATATACGGCAGATATTCGTGCT
AGTTTCGAACGTGGTACAGCTTTGTAG
Gene >Agabi119p4|116960
ATGGACTCTATGACAACAGACAAAACTGAAAGTCCTGCACGAAATGCCGATATAGTAGAGGCTGCTCTGGATACT
ACCAAGGACAGGTCACTAGACCAGGCAGAGGACTCGTCAGAAGAGACAACAACACCTGAGACGGAGGGAAATGGT
GAAGGTGAAGAGAGCGGGGAGGGAAGGAAGGTGAGTATGAAAGATAGGGAAGCAAAGTTGGCTTTGTTACGAAAG
AGATTCGTAAGTCTCTTATTGTCCAAATTGAAAACAAAATCGAAAACCCTCGCTCATTCACAGCACCTCTTTTTT
GCATATCATTATAGCATGATTCTTCCAAAGCAAACAGACAATCTCTCATTGAGGAAAGTGCGAAAGCGAAATTGA
ATGCTAGAGAACTTGCGCGGTTGGAAAGACAAAGAGCATTAGCGGATATGTTGAGGTTGAAGGCGGATGCGGAGG
AAAGAGGGGAGGATGTTGAGAGGTTTAGGAATTGGGAGTATACGATTGAGGATAATGAGAATTGGGAGAAAAAGT
TGAAGAGGAAGAAGAGGAGAGCGGATTTTGAGTTTCATGGTAAAAGTTTTTTTAAATTGATTTTTTTTTTGTGGG
GGAGGTTGCTTAACTTTTGGGTAGATGCAAGTCATGCTACTCGGCGCAAGTATAAACGAGATTTAGATCTTCTTG
AACCGGATCTTGAAGCTTATAAACGACAAAAAGCACTTGCTACAGGTGGTATACTCAATTCCTTTGACGCAAGTG
GCAGTACCAATTCGTCTCTTGTCCCAGTGCGTATATATATATATAAAAACAGAAAAACATATAGAGCAACAACTG
ACAAAAAAAAAATTTTATTTTCAGACATCGAGTTCGGTTGAACAAAAGATTGCTCATGATAACTTTTATCGGGAC
AGTTCGACACTTATTTATGCTGATGATAAACCGAGCGAGGACGCTATTGATCGTGTCGTCAGTAAGATCAATAAA
GAGTAAGCAACCCCTCCTCCCTCCCTCGAAGCTGAAACTTCACGTTCTGACAATTTTTTAATTTTGATATAGTAT
CGACAAGCGGGGCAAATTTTCACGACAACGGCTTAACGAACCCGAAGGAGACGTTACTTATATCAATGAACCAAA
TCGCGTGTTTAACAAGAAGGTACGTAATATTCTCGTGCGCGCAATTCTAATGTGACTCAAAAGCGCTTTAGATAT
CGAGATTCTATGACAAATATACGGCAGATATTCGTGCTAGTTTCGAACGTGGTACAGCTTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail