Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|116780
Gene name
Locationscaffold_09:972764..973859
Strand+
Gene length (bp)1095
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06140 Ifi-6-16 Interferon-induced 6-16 family 2.3E-09 219 292

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 207 229 22
3 231 253 22
4 273 295 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|116780
MKFAYVSIISTVLCATFVGVGASPSIFPPHVGSLLGSIPNVLKPEAHIKKVWQEVERKGPQIADQLLGQITQAHA
DVTPIVNEFKDSISKAISQARKTHDEIQEAIAGKGVTITEISTLLSREVQKIYEDLKDEVDDPLSDDHDQRSRAP
RDRAQLVSQIMEKVGIAYAVVLTGVGVPREVAETQFNDFSSTITPVILISGKIVDKYPFLLDIMIFVMSMLLLPH
LSILRPILILFGFGPLGPIKGSIAAWAQRMFWGGAVASGSWFAILQRLGMTATGSAIGNLLASAGITAMFGRGTQ
GQQDL*
Coding >Agabi119p4|116780
ATGAAGTTCGCGTATGTGTCAATAATATCTACTGTCCTATGTGCCACGTTTGTGGGTGTCGGGGCGAGTCCTTCC
ATTTTCCCTCCTCATGTTGGCAGTCTACTCGGTTCTATCCCCAATGTCCTTAAACCCGAAGCTCATATCAAGAAG
GTCTGGCAAGAGGTAGAGAGAAAAGGCCCTCAGATAGCCGACCAACTTCTGGGTCAAATAACCCAAGCACACGCC
GACGTTACGCCCATTGTCAATGAGTTTAAGGATTCCATCAGCAAAGCCATTAGTCAAGCCCGTAAGACTCACGAT
GAAATACAAGAAGCGATAGCCGGGAAGGGCGTCACGATTACAGAGATATCAACATTACTTTCCCGAGAAGTACAA
AAGATTTACGAAGATTTGAAGGACGAAGTGGACGATCCCTTGTCTGATGACCATGACCAGCGGTCAAGGGCACCA
AGGGATCGTGCACAACTCGTCTCTCAAATCATGGAAAAAGTTGGTATAGCATATGCTGTCGTCTTGACTGGTGTA
GGCGTCCCTAGGGAAGTTGCAGAAACTCAATTCAATGACTTTTCCTCCACGATTACGCCGGTCATCCTCATTTCT
GGCAAAATTGTTGACAAGTATCCTTTCCTTCTCGATATCATGATCTTTGTTATGTCGATGTTACTCCTCCCACAC
TTATCCATATTGCGGCCCATACTTATTTTATTCGGCTTTGGTCCTTTGGGTCCAATCAAAGGTTCTATTGCCGCA
TGGGCACAACGGATGTTCTGGGGTGGCGCTGTCGCGTCAGGTAGTTGGTTTGCCATTCTGCAACGACTCGGGATG
ACTGCAACAGGAAGTGCAATCGGAAATTTACTCGCTAGTGCGGGAATTACTGCAATGTTTGGTCGTGGAACCCAA
GGTCAACAAGACCTATGA
Transcript >Agabi119p4|116780
ATGAAGTTCGCGTATGTGTCAATAATATCTACTGTCCTATGTGCCACGTTTGTGGGTGTCGGGGCGAGTCCTTCC
ATTTTCCCTCCTCATGTTGGCAGTCTACTCGGTTCTATCCCCAATGTCCTTAAACCCGAAGCTCATATCAAGAAG
GTCTGGCAAGAGGTAGAGAGAAAAGGCCCTCAGATAGCCGACCAACTTCTGGGTCAAATAACCCAAGCACACGCC
GACGTTACGCCCATTGTCAATGAGTTTAAGGATTCCATCAGCAAAGCCATTAGTCAAGCCCGTAAGACTCACGAT
GAAATACAAGAAGCGATAGCCGGGAAGGGCGTCACGATTACAGAGATATCAACATTACTTTCCCGAGAAGTACAA
AAGATTTACGAAGATTTGAAGGACGAAGTGGACGATCCCTTGTCTGATGACCATGACCAGCGGTCAAGGGCACCA
AGGGATCGTGCACAACTCGTCTCTCAAATCATGGAAAAAGTTGGTATAGCATATGCTGTCGTCTTGACTGGTGTA
GGCGTCCCTAGGGAAGTTGCAGAAACTCAATTCAATGACTTTTCCTCCACGATTACGCCGGTCATCCTCATTTCT
GGCAAAATTGTTGACAAGTATCCTTTCCTTCTCGATATCATGATCTTTGTTATGTCGATGTTACTCCTCCCACAC
TTATCCATATTGCGGCCCATACTTATTTTATTCGGCTTTGGTCCTTTGGGTCCAATCAAAGGTTCTATTGCCGCA
TGGGCACAACGGATGTTCTGGGGTGGCGCTGTCGCGTCAGGTAGTTGGTTTGCCATTCTGCAACGACTCGGGATG
ACTGCAACAGGAAGTGCAATCGGAAATTTACTCGCTAGTGCGGGAATTACTGCAATGTTTGGTCGTGGAACCCAA
GGTCAACAAGACCTATGA
Gene >Agabi119p4|116780
ATGAAGTTCGCGTATGTGTCAATAATATCTACTGTCCTATGTGCCACGTTTGTGGGTGTCGGGGCGAGTCCTTCC
ATTTTCCCTCCTCATGTTGGCAGTCTACTCGGTAAGTGATATCAACCAAAACGCGCTGCGAATTTTTTTTGTAAA
TGCCGATCTCTTGGACAGGTTCTATCCCCAATGTCCTTAAACCCGAAGCTCATATCAAGAAGGTCTGGCAAGAGG
TAGAGAGAAAAGGCCCTCAGATAGCCGACCAACTTCTGGGTCAAATAACCCAAGCACACGCCGACGTTACGCCCA
TTGTCAATGAGTTTAAGGATTCCATCAGCAAAGCCATTAGTCAAGCCCGTAAGACTCACGATGAAATACAAGAAG
CGATAGCCGGGAAGGGCGTCACGATTACAGAGATATCAACATTACTTTCCCGAGAAGTACAAAAGATTTACGAAG
ATTTGAAGGACGAAGTGGACGATCCCTTGTCTGATGACCATGACCAGCGGTCAAGGGCACCAAGGGATCGTGCAC
AACTCGTCTCTCAAATCATGGAAAAAGTTGGTATAGCATATGCTGTCGTCTTGACTGGTGTAGGCGTCCCTAGGG
AAGTTGCAGAAACTCAATTCAATGACTTTTCCTCCACGATTACGCCGGTCATCCTCATTTCTGGTGAGCTCTTCG
GTCTTTTATTTGTTGTGATCCTTAAGTTAATATTCTATCATATCGCTATAGGCAAAATTGTTGACAAGTATCCTT
TCCTTCTCGATATCATGATCTTTGTTATGTCGATGTTACTCCTCCCACACTTATCCATATTGCGGCCCATACTTA
TTTTATTCGGCTTTGGTCCTTTGGGTCCAATCAAAGGTGATTTATTTTCGTTGCAGCCTCCCCACCTTCTTACAT
GGATACTTCGCAGGTTCTATTGCCGCATGGGCACAACGGATGTTCTGGGGTGGCGCTGTCGCGTCAGGTAGTTGG
TTTGCCATTCTGCAACGACTCGGGATGACTGCAACAGGAAGTGCAATCGGAAATTTACTCGCTAGTGCGGGAATT
ACTGCAATGTTTGGTCGTGGAACCCAAGGTCAACAAGACCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail