Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|116250
Gene name
Locationscaffold_09:802865..806806
Strand-
Gene length (bp)3941
Transcript length (bp)3657
Coding sequence length (bp)3657
Protein length (aa) 1219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06479 Ribonuc_2-5A Ribonuclease 2-5A 1.2E-43 1086 1213
PF00069 Pkinase Protein kinase domain 3.5E-27 752 946
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.2E-15 752 944
PF01011 PQQ PQQ enzyme repeat 6.6E-05 59 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 728 1214 2.0E-121
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 677 1213 3.0E-120
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 753 1213 1.0E-88
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 753 1213 6.0E-86
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 753 1213 3.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 728 1214 2.0E-121
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 677 1213 3.0E-120
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 753 1213 1.0E-88
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 753 1213 6.0E-86
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 753 1213 3.0E-85
sp|Q55GJ2|IREA_DICDI Probable serine/threonine-protein kinase ireA OS=Dictyostelium discoideum GN=ireA PE=3 SV=1 749 1213 1.0E-77
sp|Q9C5S2|IRE1A_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1a OS=Arabidopsis thaliana GN=IRE1A PE=1 SV=1 748 1214 1.0E-75
sp|Q93VJ2|IRE1B_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1b OS=Arabidopsis thaliana GN=IRE1B PE=2 SV=1 748 1212 1.0E-72
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 1000 1218 2.0E-51
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 1000 1213 8.0E-50
sp|Q9SF12|IRE1L_ARATH Inactive serine/threonine-protein kinase/endoribonuclease IRE1-like OS=Arabidopsis thaliana GN=At3g11870 PE=3 SV=1 656 1213 3.0E-48
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 753 944 3.0E-42
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 753 944 2.0E-39
sp|Q55DJ8|IRLC_DICDI Probable serine/threonine-protein kinase irlC OS=Dictyostelium discoideum GN=irlC PE=3 SV=1 752 1098 3.0E-33
sp|Q55DJ9|IRLD_DICDI Probable serine/threonine-protein kinase irlD OS=Dictyostelium discoideum GN=irlD PE=3 SV=1 754 1200 3.0E-33
sp|Q557G1|IRLB_DICDI Probable serine/threonine-protein kinase irlB OS=Dictyostelium discoideum GN=irlB-1 PE=3 SV=1 753 1212 2.0E-31
sp|Q559A2|IRLA_DICDI Probable serine/threonine-protein kinase irlA OS=Dictyostelium discoideum GN=irlA PE=3 SV=1 752 1203 7.0E-30
sp|Q54IE8|IRLE_DICDI Probable serine/threonine-protein kinase irlE OS=Dictyostelium discoideum GN=irlE PE=3 SV=1 753 1093 3.0E-29
sp|Q556Q3|IRLF_DICDI Probable serine/threonine-protein kinase irlF OS=Dictyostelium discoideum GN=irlF-1 PE=3 SV=1 998 1212 3.0E-18
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 754 1080 2.0E-15
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 740 1080 1.0E-14
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 754 1079 5.0E-14
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 753 943 7.0E-13
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 755 944 1.0E-12
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 755 1079 1.0E-12
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 790 1082 2.0E-12
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 755 944 3.0E-12
sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1 755 962 4.0E-12
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 755 944 4.0E-12
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 750 1079 6.0E-12
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 755 944 6.0E-12
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 755 944 7.0E-12
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 771 1079 9.0E-12
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 755 944 9.0E-12
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 750 1079 9.0E-12
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 755 944 9.0E-12
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 755 944 1.0E-11
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 755 950 1.0E-11
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 755 944 1.0E-11
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 755 944 1.0E-11
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 755 944 1.0E-11
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 755 945 2.0E-11
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 742 1080 2.0E-11
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 755 944 2.0E-11
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 753 943 3.0E-11
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 727 1080 3.0E-11
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 754 1097 4.0E-11
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 755 945 4.0E-11
sp|Q556Q3|IRLF_DICDI Probable serine/threonine-protein kinase irlF OS=Dictyostelium discoideum GN=irlF-1 PE=3 SV=1 753 878 5.0E-11
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 755 945 5.0E-11
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 755 945 5.0E-11
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 755 945 6.0E-11
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 755 945 7.0E-11
sp|Q04770|CDK2_ENTHI Cell division protein kinase 2 homolog OS=Entamoeba histolytica GN=CDC2 PE=3 SV=1 755 1080 9.0E-11
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 755 944 9.0E-11
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 755 945 1.0E-10
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 754 1080 1.0E-10
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 710 1084 1.0E-10
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 755 950 1.0E-10
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 755 945 1.0E-10
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 755 950 1.0E-10
sp|P0CD62|LIMKB_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0286997 OS=Dictyostelium discoideum GN=DDB_G0286997 PE=3 SV=1 749 945 1.0E-10
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 755 945 1.0E-10
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 755 945 2.0E-10
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 755 951 2.0E-10
sp|Q5UQ78|YR517_MIMIV Putative serine/threonine-protein kinase R517/R518 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R517 PE=3 SV=2 750 946 2.0E-10
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 753 946 2.0E-10
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 755 945 2.0E-10
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 753 1086 2.0E-10
sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1 755 1081 2.0E-10
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 755 945 2.0E-10
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 800 1085 2.0E-10
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 755 945 3.0E-10
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 745 882 3.0E-10
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 755 945 3.0E-10
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 800 1085 4.0E-10
sp|Q641Z4|CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1 755 1081 4.0E-10
sp|Q99J95|CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus GN=Cdk9 PE=1 SV=1 755 1081 4.0E-10
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 755 1079 5.0E-10
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 755 945 5.0E-10
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 800 1085 6.0E-10
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 800 1085 6.0E-10
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 800 1085 6.0E-10
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 766 1080 7.0E-10
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 754 881 7.0E-10
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 755 945 7.0E-10
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 755 948 8.0E-10
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 755 945 8.0E-10
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 755 1080 8.0E-10
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 755 948 8.0E-10
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 755 944 8.0E-10
sp|Q4KM34|CDK20_RAT Cyclin-dependent kinase 20 OS=Rattus norvegicus GN=Cdk20 PE=2 SV=2 755 951 9.0E-10
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 755 948 9.0E-10
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 755 948 9.0E-10
sp|Q9JHU3|CDK20_MOUSE Cyclin-dependent kinase 20 OS=Mus musculus GN=Cdk20 PE=1 SV=1 755 951 9.0E-10
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 729 946 9.0E-10
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 754 943 9.0E-10
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 755 943 9.0E-10
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 752 946 1.0E-09
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 755 950 1.0E-09
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 754 943 1.0E-09
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 754 943 1.0E-09
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 753 945 1.0E-09
sp|P54685|CDK7_DICDI Cyclin-dependent kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2 754 1080 1.0E-09
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 755 948 1.0E-09
sp|Q5ZKN1|CDK9_CHICK Cyclin-dependent kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1 755 1081 1.0E-09
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 754 946 1.0E-09
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 51 342 2.0E-09
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 755 946 2.0E-09
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 755 1085 2.0E-09
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 755 944 2.0E-09
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 755 943 2.0E-09
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 800 1085 2.0E-09
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 800 1085 2.0E-09
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 755 1082 2.0E-09
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 754 1090 2.0E-09
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 755 1085 2.0E-09
sp|Q54U31|SHKD_DICDI Dual specificity protein kinase shkD OS=Dictyostelium discoideum GN=shkD PE=3 SV=1 746 945 3.0E-09
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 745 1080 3.0E-09
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 755 945 3.0E-09
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 755 1080 3.0E-09
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 725 946 3.0E-09
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 754 895 3.0E-09
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 753 1124 3.0E-09
sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens GN=CDK9 PE=1 SV=3 755 1081 3.0E-09
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 755 945 3.0E-09
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 764 1080 3.0E-09
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 754 1079 3.0E-09
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 800 1085 3.0E-09
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 800 1085 4.0E-09
sp|Q1RMT8|IRAK4_BOVIN Interleukin-1 receptor-associated kinase 4 OS=Bos taurus GN=IRAK4 PE=2 SV=1 750 947 4.0E-09
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 800 1080 4.0E-09
sp|Q5EDC3|CDK20_MACMU Cyclin-dependent kinase 20 OS=Macaca mulatta GN=CDK20 PE=2 SV=1 755 918 4.0E-09
sp|Q86AE1|Y9853_DICDI Probable serine/threonine-protein kinase DDB_G0271538 OS=Dictyostelium discoideum GN=DDB_G0271538 PE=3 SV=1 755 945 5.0E-09
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 755 1085 5.0E-09
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 755 943 6.0E-09
sp|Q91727|CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis GN=cdk4 PE=1 SV=1 755 1089 6.0E-09
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 755 946 6.0E-09
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 755 944 6.0E-09
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 754 948 6.0E-09
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 747 953 6.0E-09
sp|P21965|MCK1_YEAST Protein kinase MCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCK1 PE=1 SV=1 748 945 6.0E-09
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 751 1080 6.0E-09
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 800 1085 6.0E-09
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 754 943 7.0E-09
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 771 1086 7.0E-09
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 754 943 7.0E-09
sp|Q54L00|LIMKA_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 OS=Dictyostelium discoideum GN=DDB_G0287001 PE=3 SV=1 749 945 7.0E-09
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 755 944 7.0E-09
sp|Q00094|KR73_ICHVA Protein kinase ORF73 OS=Ictalurid herpesvirus 1 (strain Auburn) GN=ORF73 PE=3 SV=1 737 899 8.0E-09
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 755 948 8.0E-09
sp|P9WI67|PKNJ_MYCTU Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknJ PE=1 SV=1 752 946 8.0E-09
sp|P9WI66|PKNJ_MYCTO Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknJ PE=1 SV=1 752 946 8.0E-09
sp|P65733|PKNJ_MYCBO Serine/threonine-protein kinase PknJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknJ PE=3 SV=1 752 946 8.0E-09
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 755 950 8.0E-09
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 755 946 9.0E-09
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 755 945 9.0E-09
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 755 946 9.0E-09
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 755 943 9.0E-09
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 755 895 9.0E-09
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 754 1079 1.0E-08
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 755 945 1.0E-08
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 755 1085 1.0E-08
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 763 943 1.0E-08
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 754 945 1.0E-08
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 754 945 1.0E-08
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 766 882 1.0E-08
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 754 948 1.0E-08
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 755 943 1.0E-08
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 766 882 1.0E-08
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 800 944 1.0E-08
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 754 948 1.0E-08
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 755 948 1.0E-08
sp|Q63572|TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus GN=Tesk1 PE=1 SV=1 789 955 1.0E-08
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 755 955 1.0E-08
sp|Q01917|CDC2H_CRIFA Cell division control protein 2 homolog OS=Crithidia fasciculata GN=CRK PE=3 SV=1 755 883 1.0E-08
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 752 944 2.0E-08
sp|Q6GLD8|CDK9_XENTR Cyclin-dependent kinase 9 OS=Xenopus tropicalis GN=cdk9 PE=2 SV=1 755 1081 2.0E-08
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 754 943 2.0E-08
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 755 948 2.0E-08
sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 755 945 2.0E-08
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 755 948 2.0E-08
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 755 945 2.0E-08
sp|Q54F40|Y1133_DICDI Probable protein kinase DDB_G0291133 OS=Dictyostelium discoideum GN=DDB_G0291133 PE=3 SV=1 755 917 2.0E-08
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 755 948 2.0E-08
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 748 943 2.0E-08
sp|G5ECH7|CDK5_CAEEL Cyclin-dependent-like kinase 5 OS=Caenorhabditis elegans GN=cdk-5 PE=1 SV=1 755 945 2.0E-08
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 754 944 2.0E-08
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 755 1077 2.0E-08
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 741 946 2.0E-08
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 797 946 2.0E-08
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 755 945 2.0E-08
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 752 945 2.0E-08
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 755 948 2.0E-08
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 753 943 2.0E-08
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 754 948 2.0E-08
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 755 943 2.0E-08
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 755 945 2.0E-08
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 735 1116 2.0E-08
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 735 1116 2.0E-08
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 56 394 3.0E-08
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 735 1116 3.0E-08
sp|Q03957|CTK1_YEAST CTD kinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTK1 PE=1 SV=1 687 953 3.0E-08
sp|Q1EBK0|SSN3_COCIM Serine/threonine-protein kinase SSN3 OS=Coccidioides immitis (strain RS) GN=SSN3 PE=3 SV=3 754 945 3.0E-08
sp|Q8QHK8|MK08_XENLA Mitogen-activated protein kinase 8 OS=Xenopus laevis GN=mapk8 PE=2 SV=2 755 1080 3.0E-08
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 800 882 3.0E-08
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 777 1077 3.0E-08
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 735 1116 3.0E-08
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 735 1116 3.0E-08
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 754 945 3.0E-08
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 755 1085 3.0E-08
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 755 945 3.0E-08
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 766 882 3.0E-08
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 755 1080 3.0E-08
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 753 951 3.0E-08
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 753 945 3.0E-08
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 777 1077 3.0E-08
sp|Q55GJ2|IREA_DICDI Probable serine/threonine-protein kinase ireA OS=Dictyostelium discoideum GN=ireA PE=3 SV=1 48 240 4.0E-08
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 755 943 4.0E-08
sp|Q9U2Q9|GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans GN=gsk-3 PE=1 SV=1 754 957 4.0E-08
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk3 PE=1 SV=3 722 957 4.0E-08
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 755 943 4.0E-08
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 754 948 4.0E-08
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 755 948 4.0E-08
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 800 944 4.0E-08
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 753 943 4.0E-08
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 755 945 4.0E-08
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 755 944 4.0E-08
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 755 945 4.0E-08
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 754 943 4.0E-08
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 755 1080 4.0E-08
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 754 948 4.0E-08
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 755 948 5.0E-08
sp|Q8AYK6|WEE1A_XENLA Wee1-like protein kinase 1-A OS=Xenopus laevis GN=wee1-a PE=2 SV=1 755 910 5.0E-08
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 755 1097 5.0E-08
sp|Q8SRI3|MRK1_ENCCU Probable serine/threonine-protein kinase MRK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MRK1 PE=3 SV=2 754 883 5.0E-08
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 755 945 5.0E-08
sp|Q9FPR3|EDR1_ARATH Serine/threonine-protein kinase EDR1 OS=Arabidopsis thaliana GN=EDR1 PE=1 SV=1 744 946 6.0E-08
sp|Q8QGV2|WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis GN=wee1-b PE=1 SV=1 755 880 6.0E-08
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 800 1080 6.0E-08
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 800 1080 6.0E-08
sp|P49185|MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus GN=Mapk8 PE=1 SV=1 755 945 6.0E-08
sp|A8XA58|CDK1_CAEBR Cyclin-dependent kinase 1 OS=Caenorhabditis briggsae GN=cdk-1 PE=3 SV=1 755 962 6.0E-08
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 800 1080 6.0E-08
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 800 1080 6.0E-08
sp|A8X5H5|GSK3_CAEBR Glycogen synthase kinase-3 OS=Caenorhabditis briggsae GN=gsk-3 PE=3 SV=1 754 957 6.0E-08
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 790 943 6.0E-08
sp|O94737|MAPK1_PNECA Mitogen-activated protein kinase 1 OS=Pneumocystis carinii GN=MKP1 PE=1 SV=1 755 943 6.0E-08
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 790 943 6.0E-08
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 754 943 6.0E-08
sp|A8WIP6|CDK20_DANRE Cyclin-dependent kinase 20 OS=Danio rerio GN=cdk20 PE=2 SV=1 755 1081 7.0E-08
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 790 943 7.0E-08
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 755 946 7.0E-08
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 754 944 7.0E-08
sp|O70146|TESK1_MOUSE Dual specificity testis-specific protein kinase 1 OS=Mus musculus GN=Tesk1 PE=1 SV=3 789 955 7.0E-08
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 755 948 7.0E-08
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 755 948 7.0E-08
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 755 1080 7.0E-08
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 754 1085 7.0E-08
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 754 943 8.0E-08
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 753 881 8.0E-08
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 754 950 8.0E-08
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 753 945 8.0E-08
sp|P45983|MK08_HUMAN Mitogen-activated protein kinase 8 OS=Homo sapiens GN=MAPK8 PE=1 SV=2 755 945 8.0E-08
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1 732 957 8.0E-08
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 58 270 9.0E-08
sp|Q91Y86|MK08_MOUSE Mitogen-activated protein kinase 8 OS=Mus musculus GN=Mapk8 PE=1 SV=1 755 945 9.0E-08
sp|Q9V3Q6|M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster GN=Tak1 PE=2 SV=1 755 945 9.0E-08
sp|A4QNA8|WEE2_XENTR Wee1-like protein kinase 2 OS=Xenopus tropicalis GN=wee2 PE=2 SV=1 755 882 1.0E-07
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 703 917 1.0E-07
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 754 943 1.0E-07
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 754 943 1.0E-07
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=1 SV=3 695 957 1.0E-07
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 755 1080 1.0E-07
sp|Q9U9Y8|NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans GN=lit-1 PE=1 SV=1 752 945 1.0E-07
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 755 945 1.0E-07
sp|P47817|WEE2A_XENLA Wee1-like protein kinase 2-A OS=Xenopus laevis GN=wee2-a PE=1 SV=2 755 893 1.0E-07
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 755 945 1.0E-07
sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS=Arabidopsis thaliana GN=WAKL22 PE=2 SV=1 752 944 1.0E-07
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 755 1090 1.0E-07
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 754 943 1.0E-07
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 753 883 1.0E-07
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 752 946 1.0E-07
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 753 946 1.0E-07
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1 732 957 1.0E-07
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 800 946 1.0E-07
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 755 1080 2.0E-07
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 748 943 2.0E-07
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 753 946 2.0E-07
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 755 944 2.0E-07
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 764 904 2.0E-07
sp|E1BMN8|NLK_BOVIN Serine/threonine-protein kinase NLK OS=Bos taurus GN=NLK PE=3 SV=2 752 945 2.0E-07
sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens GN=GSK3B PE=1 SV=2 753 957 2.0E-07
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 713 943 2.0E-07
sp|Q9WV60|GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus musculus GN=Gsk3b PE=1 SV=2 753 957 2.0E-07
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 754 964 2.0E-07
sp|P18431|SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster GN=sgg PE=1 SV=3 754 953 2.0E-07
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 764 904 2.0E-07
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 713 943 2.0E-07
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 729 945 2.0E-07
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 749 946 2.0E-07
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 755 945 2.0E-07
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 755 948 2.0E-07
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 713 943 2.0E-07
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 713 943 2.0E-07
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 755 955 2.0E-07
sp|Q5YJC2|GSK3B_SPECI Glycogen synthase kinase-3 beta OS=Spermophilus citellus GN=GSK3B PE=2 SV=1 754 957 2.0E-07
sp|P18266|GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus norvegicus GN=Gsk3b PE=1 SV=1 753 957 2.0E-07
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 755 1080 2.0E-07
sp|D3ZSZ3|NLK_RAT Serine/threonine-protein kinase NLK OS=Rattus norvegicus GN=Nlk PE=3 SV=1 752 945 2.0E-07
sp|O54949|NLK_MOUSE Serine/threonine-protein kinase NLK OS=Mus musculus GN=Nlk PE=1 SV=2 752 945 2.0E-07
sp|E2QWQ2|NLK_CANLF Serine/threonine-protein kinase NLK OS=Canis lupus familiaris GN=NLK PE=3 SV=1 752 945 2.0E-07
sp|Q9UBE8|NLK_HUMAN Serine/threonine-protein kinase NLK OS=Homo sapiens GN=NLK PE=1 SV=2 752 945 2.0E-07
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 734 917 2.0E-07
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 754 943 2.0E-07
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2 732 957 2.0E-07
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 755 958 2.0E-07
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 764 904 2.0E-07
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 755 1090 2.0E-07
sp|Q61831|MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus GN=Mapk10 PE=1 SV=2 755 945 2.0E-07
sp|Q8NU97|PKN2_CORGL Serine/threonine-protein kinases PknA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknA PE=3 SV=1 754 946 2.0E-07
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 755 1098 2.0E-07
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 735 946 2.0E-07
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 752 946 2.0E-07
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 745 946 2.0E-07
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 754 946 2.0E-07
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 800 1079 2.0E-07
sp|Q91757|GSK3B_XENLA Glycogen synthase kinase-3 beta OS=Xenopus laevis GN=gsk3b PE=1 SV=1 753 957 2.0E-07
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 59 247 3.0E-07
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 755 962 3.0E-07
sp|Q9TVL3|CDK9_CAEEL Probable cyclin-dependent kinase 9 OS=Caenorhabditis elegans GN=cdk-9 PE=3 SV=2 753 946 3.0E-07
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 754 946 3.0E-07
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 753 944 3.0E-07
sp|Q8SSH1|Y255_ENCCU Probable serine/threonine-protein kinase ECU02_0550 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0550 PE=3 SV=1 753 946 3.0E-07
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 755 943 3.0E-07
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 753 943 3.0E-07
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 755 945 3.0E-07
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 755 944 3.0E-07
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 800 946 3.0E-07
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 752 946 3.0E-07
sp|P53779|MK10_HUMAN Mitogen-activated protein kinase 10 OS=Homo sapiens GN=MAPK10 PE=1 SV=2 755 945 3.0E-07
sp|Q4V862|CDK9A_XENLA Cyclin-dependent kinase 9-A OS=Xenopus laevis GN=cdk9-a PE=2 SV=1 755 1081 3.0E-07
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 755 946 3.0E-07
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 755 946 3.0E-07
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 755 945 3.0E-07
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 761 947 3.0E-07
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 755 883 3.0E-07
sp|Q9ZR79|LRK57_ARATH L-type lectin-domain containing receptor kinase V.7 OS=Arabidopsis thaliana GN=LECRK57 PE=2 SV=2 754 944 3.0E-07
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 754 945 3.0E-07
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 754 943 3.0E-07
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 755 945 3.0E-07
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 754 943 3.0E-07
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 59 247 4.0E-07
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 754 947 4.0E-07
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 755 1098 4.0E-07
sp|P06242|KIN28_YEAST Serine/threonine-protein kinase KIN28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN28 PE=1 SV=1 755 945 4.0E-07
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 755 944 4.0E-07
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 754 943 4.0E-07
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 754 946 4.0E-07
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 755 945 4.0E-07
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 755 945 4.0E-07
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 755 945 4.0E-07
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 754 943 4.0E-07
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 754 946 4.0E-07
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 754 946 4.0E-07
sp|Q9NWZ3|IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens GN=IRAK4 PE=1 SV=1 750 947 4.0E-07
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 789 946 4.0E-07
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 754 945 4.0E-07
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 764 882 4.0E-07
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 789 1080 4.0E-07
sp|Q15569|TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens GN=TESK1 PE=1 SV=2 789 955 4.0E-07
sp|P47810|WEE1_MOUSE Wee1-like protein kinase OS=Mus musculus GN=Wee1 PE=1 SV=2 755 880 4.0E-07
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 755 947 5.0E-07
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 754 945 5.0E-07
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 755 945 5.0E-07
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 755 944 5.0E-07
sp|Q7ZX42|CDK9B_XENLA Cyclin-dependent kinase 9-B OS=Xenopus laevis GN=cdk9-b PE=2 SV=1 755 946 5.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 753 951 5.0E-07
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 755 946 5.0E-07
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 753 946 5.0E-07
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 754 943 5.0E-07
sp|A2Y4B6|CDKD1_ORYSI Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. indica GN=CDKD-1 PE=2 SV=1 754 945 5.0E-07
sp|Q6DFE0|WEE2C_XENLA Wee1-like protein kinase 2-C OS=Xenopus laevis GN=wee2-c PE=2 SV=1 786 882 5.0E-07
sp|P29620|CDKD1_ORYSJ Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. japonica GN=CDKD-1 PE=1 SV=1 754 945 6.0E-07
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 755 944 6.0E-07
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 754 943 6.0E-07
sp|Q54TA1|DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum GN=drkC PE=3 SV=1 747 946 6.0E-07
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 755 945 6.0E-07
sp|O57473|WEE2B_XENLA Wee1-like protein kinase 2-B OS=Xenopus laevis GN=wee2-b PE=1 SV=1 786 882 6.0E-07
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 755 944 6.0E-07
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1 732 957 6.0E-07
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 754 1079 6.0E-07
sp|Q8R4K2|IRAK4_MOUSE Interleukin-1 receptor-associated kinase 4 OS=Mus musculus GN=Irak4 PE=1 SV=1 753 947 6.0E-07
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 755 946 6.0E-07
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 755 945 7.0E-07
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 755 945 7.0E-07
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 755 946 7.0E-07
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 755 883 7.0E-07
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 755 1098 7.0E-07
sp|Q96285|LRK55_ARATH L-type lectin-domain containing receptor kinase V.5 OS=Arabidopsis thaliana GN=LECRK55 PE=1 SV=1 754 944 7.0E-07
sp|B1H3E1|NLK2_XENTR Serine/threonine-protein kinase NLK2 OS=Xenopus tropicalis GN=nlk.2 PE=2 SV=1 725 945 7.0E-07
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 755 953 7.0E-07
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 755 946 8.0E-07
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 755 1098 8.0E-07
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 755 943 8.0E-07
sp|P49187|MK10_RAT Mitogen-activated protein kinase 10 OS=Rattus norvegicus GN=Mapk10 PE=1 SV=2 755 945 8.0E-07
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 755 946 8.0E-07
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 725 950 8.0E-07
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 755 882 8.0E-07
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 755 942 8.0E-07
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 59 270 9.0E-07
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 753 946 9.0E-07
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 754 944 9.0E-07
sp|F1N9Y5|KSYK_CHICK Tyrosine-protein kinase SYK OS=Gallus gallus GN=SYK PE=1 SV=2 738 943 9.0E-07
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 800 943 9.0E-07
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 766 882 9.0E-07
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 755 1098 9.0E-07
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 742 944 1.0E-06
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 790 943 1.0E-06
sp|O44408|KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans GN=kgb-1 PE=1 SV=2 746 945 1.0E-06
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 790 943 1.0E-06
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 752 955 1.0E-06
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 755 945 1.0E-06
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 754 943 1.0E-06
sp|Q63802|WEE1_RAT Wee1-like protein kinase OS=Rattus norvegicus GN=Wee1 PE=1 SV=1 755 880 1.0E-06
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 754 943 1.0E-06
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 755 945 1.0E-06
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 754 943 1.0E-06
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 755 945 1.0E-06
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 749 946 1.0E-06
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 755 945 1.0E-06
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 741 944 1.0E-06
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 769 952 1.0E-06
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 755 945 1.0E-06
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 800 943 1.0E-06
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 755 944 1.0E-06
sp|Q8WQG9|JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans GN=jnk-1 PE=1 SV=2 729 945 1.0E-06
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 754 941 1.0E-06
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 754 943 1.0E-06
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 790 943 1.0E-06
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 755 946 1.0E-06
sp|Q9M1Z9|LRK58_ARATH Putative L-type lectin-domain containing receptor kinase V.8 OS=Arabidopsis thaliana GN=LECRK58 PE=3 SV=1 754 944 1.0E-06
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 762 943 2.0E-06
sp|P0C5E2|Y1839_ARATH Probable serine/threonine-protein kinase At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=2 SV=2 755 941 2.0E-06
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 769 952 2.0E-06
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 765 945 2.0E-06
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 750 943 2.0E-06
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 704 951 2.0E-06
sp|Q2PQN9|CDK5_GLOMM Cyclin-dependent kinase 5 homolog OS=Glossina morsitans morsitans GN=Cdk5 PE=2 SV=1 755 945 2.0E-06
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 755 945 2.0E-06
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 704 951 2.0E-06
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 754 946 2.0E-06
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 755 943 2.0E-06
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 755 945 2.0E-06
sp|P24923|CDC21_MEDSA Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1 755 945 2.0E-06
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 745 943 2.0E-06
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 754 946 2.0E-06
sp|Q8QGV6|NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis GN=nlk.2 PE=1 SV=1 738 945 2.0E-06
sp|Q9YHZ5|PIM2_DANRE Serine/threonine-protein kinase pim-2 OS=Danio rerio GN=pim2 PE=2 SV=2 753 902 2.0E-06
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 754 946 2.0E-06
sp|Q336M2|CDKE1_ORYSJ Cyclin-dependent kinase E-1 OS=Oryza sativa subsp. japonica GN=CDKE-1 PE=2 SV=2 770 945 2.0E-06
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 755 943 2.0E-06
sp|Q9LEA3|LRK56_ARATH Putative L-type lectin-domain containing receptor kinase V.6 OS=Arabidopsis thaliana GN=LECRK56 PE=3 SV=3 754 944 2.0E-06
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 754 946 2.0E-06
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 746 901 2.0E-06
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 735 944 3.0E-06
sp|P06784|STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE7 PE=1 SV=1 755 947 3.0E-06
sp|Q9U6D2|JNK1_ANCCA Stress-activated protein kinase JNK-1 OS=Ancylostoma caninum GN=JNK-1 PE=2 SV=2 754 945 3.0E-06
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 754 943 3.0E-06
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 755 945 3.0E-06
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 755 1011 3.0E-06
sp|A1CHL6|ATG1_ASPCL Serine/threonine-protein kinase atg1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg1 PE=3 SV=1 755 946 3.0E-06
sp|Q9SYS3|CRK40_ARATH Cysteine-rich receptor-like protein kinase 40 OS=Arabidopsis thaliana GN=CRK40 PE=2 SV=1 751 943 3.0E-06
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 755 945 3.0E-06
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 755 952 3.0E-06
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 754 943 3.0E-06
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 724 1087 3.0E-06
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 755 880 3.0E-06
sp|E1BTE1|WEE2_CHICK Wee1-like protein kinase 2 OS=Gallus gallus GN=WEE2 PE=3 SV=1 755 882 3.0E-06
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 744 944 4.0E-06
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 744 944 4.0E-06
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 753 944 4.0E-06
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 753 943 4.0E-06
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 754 945 4.0E-06
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 755 945 4.0E-06
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 755 945 4.0E-06
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 753 943 4.0E-06
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 755 943 4.0E-06
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 755 943 4.0E-06
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 753 943 4.0E-06
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 755 943 4.0E-06
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 755 896 4.0E-06
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 755 945 4.0E-06
sp|O13958|SSN3_SCHPO Serine/threonine-protein kinase srb10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srb10 PE=1 SV=2 753 945 4.0E-06
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 755 943 4.0E-06
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 755 943 4.0E-06
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 755 943 4.0E-06
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 755 943 4.0E-06
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 755 943 4.0E-06
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 739 943 4.0E-06
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 766 882 4.0E-06
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 702 946 4.0E-06
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 753 943 4.0E-06
sp|P31152|MK04_HUMAN Mitogen-activated protein kinase 4 OS=Homo sapiens GN=MAPK4 PE=1 SV=2 755 943 4.0E-06
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 755 943 5.0E-06
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 755 904 5.0E-06
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 755 943 5.0E-06
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 800 943 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006397 mRNA processing Yes
GO:0006468 protein phosphorylation Yes
GO:0004672 protein kinase activity Yes
GO:0004540 ribonuclease activity Yes
GO:0036094 small molecule binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006396 RNA processing No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016310 phosphorylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0036211 protein modification process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017076 purine nucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0043167 ion binding No
GO:0016071 mRNA metabolic process No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0043412 macromolecule modification No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016070 RNA metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|116250
MLFFPLLVVATVALARILSIHPPHPAHSALAERPNPYQYSHAARDQPDAHLDDLELLDIVLLASVDGKLHALNRT
SGETLWSMTPASNSSSSSPAALSPLVRTDHIDYDPEVTDDNSQAAYIIEPQSGDIYIMPNPSSPLQRFPFSMQEL
VDMSPFSFRGEDDSRVFVGKKETSLLVVELQTGKIKATLNSECPWDQFDNIKDELDLDELEDSVPPKTPPAEVYI
GRTDYHVSIISTRSGKLDGSVTRPPIQNLSFSTYGPNRQDSHIQSLYRRTKDNTYIQSLPSGELLSFKAKSSVDS
IATTYNDHLLWARNAFSQPIVAVFDVVNRKPSSKLDISTHPFVLLQPRPRIHDLIPGLSPMTKESPLSAYIGLVE
ETGSLFALTPNRFPLVAFGRPQNQPQQRKGHPLLDGKDGLSGEDEDEDEEVTSVDEITRRRKLHEAKSSLSSSHR
LEENLQCHATILNDRRCLVGIHRLELDQGDGHETRMKRLLDASPEQNDYIDPSSYSQQQSPSNESKNRPLSIDPP
TEASDDVSPSPVFAGSGVFGIGKAVWTTLILGFLVTFGILRWKSGSSWIVQKDVVEQQPTVINITQNDVSAVVAK
EIKEIREEPISSKQNQASSPLVLPPVTASTVKPLPPTPQLPTGAGDETDKEDLDGGVQTEGENDDLPAAPAVGRG
NDPTTPKKKTRRGKRGAKKAKNGTGDPVPNDMKMNGKDVVVDLGEEGTKLPKMPSSLILTSTPKAVSAPKPSLVV
SDNILGYGSHGTVVYKGSLQGRAVAVKRLLADFVTLASREVSILQESDDHPNVIRYYYQEAHAGFLYIALELCPA
SLADLIEMPDRDAWRDIAVSFDPKRALKQVTNGLRHLHALKLVHRDIKPQNILVSTKGGGLSGAGSGGGAAARGT
NYRMLISDFGLCKKLDVDQTSFMPTVHGAMAAGTVGWRAPEILRGEVKLDDEMGDDQSSRGSNATIHGGNHNSST
HSTSSSNSSSSSSSNPGKGRRTKLTKSVDIFALGCLYYYTLTGGGHPFGDRYEREVNIMKNEKNLEMLERFGEEG
TEAADLIEKMLDPIPSERPDTTSCLLHPFFWDCSRRLNFLQEASDRFEFMCRDPKDPDLLALEENVQGIIGNDWH
LRMDRLFIENLGKYRKYDGRSVQDLLRALRNKKHHYQDLPDNVKRHLGPMPEGFLAYFTRRFPRLFLHVHRVVRE
TGLANESVFRSYFELPDS*
Coding >Agabi119p4|116250
ATGCTCTTCTTCCCTCTCCTCGTCGTAGCCACCGTCGCCCTCGCCCGCATCCTCTCTATCCATCCCCCGCATCCC
GCCCACTCTGCCCTCGCAGAACGCCCGAATCCATACCAATACTCACACGCCGCCCGCGACCAGCCAGATGCCCAT
CTCGATGACTTGGAGCTCCTCGACATCGTCCTCTTGGCCTCGGTCGACGGCAAACTCCATGCGCTCAACCGCACC
TCTGGCGAAACCCTCTGGTCCATGACCCCCGCTTCCAACTCCTCGTCTTCCAGCCCCGCAGCATTATCTCCCCTA
GTCCGCACAGACCATATAGACTATGATCCAGAGGTCACCGATGACAACAGCCAAGCTGCCTATATCATAGAGCCG
CAGTCGGGCGACATCTATATCATGCCGAATCCGTCCTCGCCCCTTCAACGCTTCCCTTTTTCCATGCAGGAACTT
GTCGATATGTCCCCTTTTAGTTTCAGAGGCGAGGACGACAGCAGGGTCTTTGTAGGCAAAAAGGAAACATCTCTG
CTCGTCGTCGAATTGCAAACTGGTAAAATCAAGGCAACTCTCAATTCCGAATGCCCTTGGGACCAGTTTGATAAT
ATCAAGGACGAGTTAGATTTGGATGAGTTGGAGGACAGCGTACCGCCGAAAACCCCTCCCGCTGAAGTCTATATT
GGTCGTACCGACTACCATGTATCGATCATATCCACACGTTCTGGAAAGCTTGATGGATCCGTTACCCGGCCCCCC
ATTCAAAATCTTTCTTTTTCTACATATGGCCCTAACAGACAGGACAGCCACATTCAGTCCCTTTACCGCCGCACC
AAAGACAACACCTATATCCAATCGTTGCCTAGTGGCGAACTCCTTTCTTTCAAAGCCAAATCCTCCGTCGACTCC
ATCGCTACTACTTACAACGACCATTTATTATGGGCGCGCAATGCTTTCAGTCAACCCATTGTCGCTGTTTTTGAT
GTCGTGAACCGCAAACCATCATCCAAATTAGACATCTCAACTCATCCTTTCGTTCTGCTTCAACCTCGACCTCGG
ATACATGATCTTATACCCGGTCTTTCCCCCATGACAAAGGAATCCCCACTTTCAGCTTACATTGGACTAGTTGAA
GAAACTGGCAGTTTGTTCGCTCTTACACCAAATCGTTTCCCGTTGGTCGCCTTTGGTCGTCCACAAAATCAACCA
CAACAACGAAAAGGTCATCCACTACTCGACGGCAAAGACGGTCTTTCTGGAGAAGATGAAGATGAAGATGAAGAA
GTCACGAGTGTAGACGAAATAACTCGACGTAGGAAGCTACATGAAGCCAAATCTTCTCTGTCGTCATCTCATCGG
TTGGAAGAGAACCTCCAATGTCATGCGACGATTCTAAACGATCGAAGATGCCTAGTTGGTATCCACAGACTCGAA
TTAGATCAAGGTGATGGTCACGAAACGAGGATGAAACGTTTATTGGATGCATCACCTGAACAGAACGATTATATC
GATCCATCATCCTATTCTCAACAACAATCTCCTTCCAATGAAAGTAAAAACCGCCCTTTGAGTATCGATCCTCCA
ACTGAAGCATCTGATGATGTTTCTCCATCACCGGTATTTGCTGGGAGCGGTGTTTTTGGTATTGGGAAAGCAGTA
TGGACGACTTTGATTTTGGGATTTTTAGTGACGTTTGGGATTTTGAGATGGAAGAGTGGTTCTTCTTGGATCGTG
CAGAAGGACGTGGTGGAACAACAACCAACGGTTATAAATATAACCCAAAATGACGTGTCAGCGGTAGTGGCGAAA
GAGATAAAGGAAATTCGAGAGGAGCCGATATCTTCCAAACAAAATCAAGCTTCCTCGCCTTTGGTATTGCCTCCG
GTGACAGCATCGACCGTCAAACCGCTGCCACCTACTCCCCAACTGCCTACTGGGGCCGGAGACGAAACAGATAAA
GAAGATCTGGACGGAGGGGTTCAAACAGAAGGAGAGAATGATGATCTCCCTGCTGCTCCTGCTGTTGGGCGTGGC
AACGATCCAACGACACCCAAAAAGAAAACGCGAAGAGGCAAACGAGGTGCTAAGAAAGCTAAAAATGGGACTGGA
GATCCCGTACCGAATGATATGAAGATGAATGGGAAAGACGTTGTGGTAGATCTTGGTGAAGAAGGAACGAAACTA
CCGAAAATGCCGAGTTCGTTGATTTTGACAAGTACTCCGAAAGCTGTAAGCGCTCCAAAACCTTCATTGGTCGTT
TCCGATAACATCCTCGGTTACGGCTCTCATGGGACTGTGGTCTACAAGGGTTCACTCCAAGGTCGAGCAGTGGCA
GTCAAGCGTCTTTTGGCCGATTTCGTCACGCTCGCTTCTCGTGAAGTATCGATTTTACAAGAATCCGATGATCAT
CCAAACGTCATTCGATACTACTATCAAGAAGCTCATGCTGGATTCCTATATATCGCTTTGGAGCTATGTCCGGCG
AGTTTGGCGGATTTGATTGAGATGCCGGATAGAGATGCCTGGAGGGATATTGCTGTTAGCTTTGACCCGAAGAGA
GCGCTGAAGCAGGTTACAAATGGCTTGAGACATTTGCATGCTTTGAAATTGGTTCATAGGGATATTAAGCCCCAG
AATATTTTGGTTTCGACTAAGGGTGGTGGGCTCAGTGGTGCGGGGAGTGGGGGAGGCGCAGCAGCGAGGGGAACG
AATTATCGGATGTTGATTTCGGATTTTGGGTTGTGTAAGAAATTGGATGTGGACCAGACGAGTTTTATGCCCACT
GTTCATGGGGCTATGGCTGCTGGTACTGTTGGTTGGCGTGCACCGGAGATATTACGGGGTGAAGTCAAGTTGGAT
GATGAAATGGGAGACGATCAGTCATCTCGGGGTTCTAATGCTACCATCCACGGCGGAAATCATAACTCTTCCACC
CATTCAACGTCTTCGAGTAACTCTTCGTCCTCATCCTCGTCAAACCCTGGCAAGGGGAGACGAACGAAATTGACG
AAGAGTGTGGATATTTTTGCGTTGGGATGTTTGTATTACTATACTTTGACTGGAGGCGGTCATCCGTTTGGGGAT
AGGTATGAGAGGGAAGTGAATATAATGAAGAATGAGAAGAATCTGGAGATGTTGGAGAGGTTTGGAGAGGAAGGT
ACTGAAGCTGCGGATTTGATTGAAAAAATGTTGGATCCTATACCCTCTGAACGCCCGGATACAACGTCGTGTCTG
TTACATCCATTTTTCTGGGACTGTTCAAGACGATTAAATTTCTTGCAAGAAGCATCGGATCGATTTGAATTCATG
TGTAGGGATCCGAAAGATCCTGATCTATTAGCTTTGGAGGAGAATGTGCAGGGTATAATTGGGAATGATTGGCAT
TTGAGGATGGATAGATTGTTTATTGAGAATTTGGGGAAATATAGGAAGTATGATGGGAGGAGTGTACAAGATTTG
TTGAGAGCTTTGAGGAATAAGAAACATCATTATCAAGATTTACCGGATAATGTCAAACGGCATTTAGGACCTATG
CCGGAAGGGTTCCTGGCGTATTTCACGAGAAGATTTCCGAGATTGTTTTTGCATGTACATCGAGTGGTGAGAGAA
ACGGGGCTTGCCAATGAATCGGTTTTTAGAAGTTATTTCGAGTTGCCGGATTCATGA
Transcript >Agabi119p4|116250
ATGCTCTTCTTCCCTCTCCTCGTCGTAGCCACCGTCGCCCTCGCCCGCATCCTCTCTATCCATCCCCCGCATCCC
GCCCACTCTGCCCTCGCAGAACGCCCGAATCCATACCAATACTCACACGCCGCCCGCGACCAGCCAGATGCCCAT
CTCGATGACTTGGAGCTCCTCGACATCGTCCTCTTGGCCTCGGTCGACGGCAAACTCCATGCGCTCAACCGCACC
TCTGGCGAAACCCTCTGGTCCATGACCCCCGCTTCCAACTCCTCGTCTTCCAGCCCCGCAGCATTATCTCCCCTA
GTCCGCACAGACCATATAGACTATGATCCAGAGGTCACCGATGACAACAGCCAAGCTGCCTATATCATAGAGCCG
CAGTCGGGCGACATCTATATCATGCCGAATCCGTCCTCGCCCCTTCAACGCTTCCCTTTTTCCATGCAGGAACTT
GTCGATATGTCCCCTTTTAGTTTCAGAGGCGAGGACGACAGCAGGGTCTTTGTAGGCAAAAAGGAAACATCTCTG
CTCGTCGTCGAATTGCAAACTGGTAAAATCAAGGCAACTCTCAATTCCGAATGCCCTTGGGACCAGTTTGATAAT
ATCAAGGACGAGTTAGATTTGGATGAGTTGGAGGACAGCGTACCGCCGAAAACCCCTCCCGCTGAAGTCTATATT
GGTCGTACCGACTACCATGTATCGATCATATCCACACGTTCTGGAAAGCTTGATGGATCCGTTACCCGGCCCCCC
ATTCAAAATCTTTCTTTTTCTACATATGGCCCTAACAGACAGGACAGCCACATTCAGTCCCTTTACCGCCGCACC
AAAGACAACACCTATATCCAATCGTTGCCTAGTGGCGAACTCCTTTCTTTCAAAGCCAAATCCTCCGTCGACTCC
ATCGCTACTACTTACAACGACCATTTATTATGGGCGCGCAATGCTTTCAGTCAACCCATTGTCGCTGTTTTTGAT
GTCGTGAACCGCAAACCATCATCCAAATTAGACATCTCAACTCATCCTTTCGTTCTGCTTCAACCTCGACCTCGG
ATACATGATCTTATACCCGGTCTTTCCCCCATGACAAAGGAATCCCCACTTTCAGCTTACATTGGACTAGTTGAA
GAAACTGGCAGTTTGTTCGCTCTTACACCAAATCGTTTCCCGTTGGTCGCCTTTGGTCGTCCACAAAATCAACCA
CAACAACGAAAAGGTCATCCACTACTCGACGGCAAAGACGGTCTTTCTGGAGAAGATGAAGATGAAGATGAAGAA
GTCACGAGTGTAGACGAAATAACTCGACGTAGGAAGCTACATGAAGCCAAATCTTCTCTGTCGTCATCTCATCGG
TTGGAAGAGAACCTCCAATGTCATGCGACGATTCTAAACGATCGAAGATGCCTAGTTGGTATCCACAGACTCGAA
TTAGATCAAGGTGATGGTCACGAAACGAGGATGAAACGTTTATTGGATGCATCACCTGAACAGAACGATTATATC
GATCCATCATCCTATTCTCAACAACAATCTCCTTCCAATGAAAGTAAAAACCGCCCTTTGAGTATCGATCCTCCA
ACTGAAGCATCTGATGATGTTTCTCCATCACCGGTATTTGCTGGGAGCGGTGTTTTTGGTATTGGGAAAGCAGTA
TGGACGACTTTGATTTTGGGATTTTTAGTGACGTTTGGGATTTTGAGATGGAAGAGTGGTTCTTCTTGGATCGTG
CAGAAGGACGTGGTGGAACAACAACCAACGGTTATAAATATAACCCAAAATGACGTGTCAGCGGTAGTGGCGAAA
GAGATAAAGGAAATTCGAGAGGAGCCGATATCTTCCAAACAAAATCAAGCTTCCTCGCCTTTGGTATTGCCTCCG
GTGACAGCATCGACCGTCAAACCGCTGCCACCTACTCCCCAACTGCCTACTGGGGCCGGAGACGAAACAGATAAA
GAAGATCTGGACGGAGGGGTTCAAACAGAAGGAGAGAATGATGATCTCCCTGCTGCTCCTGCTGTTGGGCGTGGC
AACGATCCAACGACACCCAAAAAGAAAACGCGAAGAGGCAAACGAGGTGCTAAGAAAGCTAAAAATGGGACTGGA
GATCCCGTACCGAATGATATGAAGATGAATGGGAAAGACGTTGTGGTAGATCTTGGTGAAGAAGGAACGAAACTA
CCGAAAATGCCGAGTTCGTTGATTTTGACAAGTACTCCGAAAGCTGTAAGCGCTCCAAAACCTTCATTGGTCGTT
TCCGATAACATCCTCGGTTACGGCTCTCATGGGACTGTGGTCTACAAGGGTTCACTCCAAGGTCGAGCAGTGGCA
GTCAAGCGTCTTTTGGCCGATTTCGTCACGCTCGCTTCTCGTGAAGTATCGATTTTACAAGAATCCGATGATCAT
CCAAACGTCATTCGATACTACTATCAAGAAGCTCATGCTGGATTCCTATATATCGCTTTGGAGCTATGTCCGGCG
AGTTTGGCGGATTTGATTGAGATGCCGGATAGAGATGCCTGGAGGGATATTGCTGTTAGCTTTGACCCGAAGAGA
GCGCTGAAGCAGGTTACAAATGGCTTGAGACATTTGCATGCTTTGAAATTGGTTCATAGGGATATTAAGCCCCAG
AATATTTTGGTTTCGACTAAGGGTGGTGGGCTCAGTGGTGCGGGGAGTGGGGGAGGCGCAGCAGCGAGGGGAACG
AATTATCGGATGTTGATTTCGGATTTTGGGTTGTGTAAGAAATTGGATGTGGACCAGACGAGTTTTATGCCCACT
GTTCATGGGGCTATGGCTGCTGGTACTGTTGGTTGGCGTGCACCGGAGATATTACGGGGTGAAGTCAAGTTGGAT
GATGAAATGGGAGACGATCAGTCATCTCGGGGTTCTAATGCTACCATCCACGGCGGAAATCATAACTCTTCCACC
CATTCAACGTCTTCGAGTAACTCTTCGTCCTCATCCTCGTCAAACCCTGGCAAGGGGAGACGAACGAAATTGACG
AAGAGTGTGGATATTTTTGCGTTGGGATGTTTGTATTACTATACTTTGACTGGAGGCGGTCATCCGTTTGGGGAT
AGGTATGAGAGGGAAGTGAATATAATGAAGAATGAGAAGAATCTGGAGATGTTGGAGAGGTTTGGAGAGGAAGGT
ACTGAAGCTGCGGATTTGATTGAAAAAATGTTGGATCCTATACCCTCTGAACGCCCGGATACAACGTCGTGTCTG
TTACATCCATTTTTCTGGGACTGTTCAAGACGATTAAATTTCTTGCAAGAAGCATCGGATCGATTTGAATTCATG
TGTAGGGATCCGAAAGATCCTGATCTATTAGCTTTGGAGGAGAATGTGCAGGGTATAATTGGGAATGATTGGCAT
TTGAGGATGGATAGATTGTTTATTGAGAATTTGGGGAAATATAGGAAGTATGATGGGAGGAGTGTACAAGATTTG
TTGAGAGCTTTGAGGAATAAGAAACATCATTATCAAGATTTACCGGATAATGTCAAACGGCATTTAGGACCTATG
CCGGAAGGGTTCCTGGCGTATTTCACGAGAAGATTTCCGAGATTGTTTTTGCATGTACATCGAGTGGTGAGAGAA
ACGGGGCTTGCCAATGAATCGGTTTTTAGAAGTTATTTCGAGTTGCCGGATTCATGA
Gene >Agabi119p4|116250
ATGCTCTTCTTCCCTCTCCTCGTCGTAGCCACCGTCGCCCTCGCCCGCATCCTCTCTATCCATCCCCCGCATCCC
GCCCACTCTGCCCTCGCAGAACGCCCGAATCCATACCAATACTCACACGCCGCCCGCGACCAGCCAGATGCCCAT
CTCGATGACTTGGAGCTCCTCGACATCGTCCTCTTGGCCTCGGTCGACGGCAAACTCCATGCGCTCAACCGCACC
TCTGGCGAAACCCTCTGGTCCATGACCCCCGCTTCCAACTCCTCGTCTTCCAGCCCCGCAGCATTATCTCCCCTA
GTCCGCACAGACCATATAGACTATGATCCAGAGGTCACCGATGACAACAGCCAAGCTGCCTATATCATAGAGCCG
CAGTCGGGCGACATCTATATCATGCCGAATCCGTCCTCGCCCCTTCAACGCTTCCCTTTTTCCATGCAGGAACTT
GTCGATATGTCCCCTTTTAGTTTCAGAGGCGAGGACGACAGCAGGGTCTTTGTAGGCAAAAAGGAAACATCTCTG
CTCGTCGTCGAATTGCAAACTGGTAAAATCAAGGCAACTCTCAATTCCGAATGCCCTTGGGACCAGTTTGATAAT
ATCAAGGACGAGTTAGATTTGGATGAGTTGGAGGACAGCGTACCGCCGAAAACCCCTCCCGCTGAAGTCTATATT
GGTCGTACCGGTATGATCTCCCCGCTCTTTTTTCAACGCGCGGCTAAAAGCGCGGCACAGACTACCATGTATCGA
TCATATCCACACGTTCTGGAAAGCTTGATGGATCCGTTACCCGGCCCCCCATTCAAAATCTTTCTTTTTCTACAT
ATGGCCCTAACAGACAGGACAGCCACATTCAGTCCCTTTACCGCCGCACCAAAGACAACACCTATATCCAATCGT
TGCCTAGTGGCGAACTCCTTTCTTTCAAAGCCAAATCCTCCGTCGACTCCATCGCTACTACTTACAACGACCATT
TATTATGGGCGCGCAATGCTTTCAGTCAACCCATGTAAGTTGACATCAATCTATAAATTTGCATGTATTAAGATC
TGTTCAGTGTCGCTGTTTTTGATGTCGTGAACCGCAAACCATCATCCAAATTAGACATCTCAACTCATCCTTTCG
TTCTGCTTCAACCTCGACCTCGGATACATGATCTTATACCCGGTCTTTCCCCCATGACAAAGGAATCCCCACTTT
CAGCTTACATTGGACTAGTTGAAGAAACTGGCAGTTTGTTCGCTCTTACACCAAATCGTTTCCCGTTGGTCGCCT
TTGGTCGTCCACAAAATCAACCACAACAACGAAAAGGTCATCCACTACTCGACGGCAAAGACGGTCTTTCTGGAG
AAGATGAAGATGAAGATGAAGAAGTCACGAGTGTAGACGAAATAACTCGACGTAGGAAGCTACATGAAGCCAAAT
CTTCTCTGTCGTCATCTCATCGGTTGGAAGAGAACCTCCAATGTCATGCGACGATTCTAAACGATCGAAGATGCC
TAGTTGGTATCCACAGACTCGAATTAGATCAAGGTGATGGTCACGAAACGAGGATGAAACGTTTATTGGATGCAT
CACCTGAACAGAACGATTATATCGATCCATCATCCTATTCTCAACAACAATCTCCTTCCAATGAAAGTAAAAACC
GCCCTTTGAGTATCGATCCTCCAACTGAAGCATCTGATGATGTTTCTCCATCACCGGTATTTGCTGGGAGCGGTG
TTTTTGGTATTGGGAAAGCAGTATGGACGACTTTGATTTTGGGATTTTTAGTGACGTTTGGGATTTTGAGATGGA
AGAGTGGTTCTTCTTGGATCGTGCAGAAGGACGTGGTGGAACAACAACCAACGGTTATAAATATAACCCAAAATG
ACGTGTCAGCGGTAGTGGCGAAAGAGATAAAGGAAATTCGAGAGGAGCCGATATCTTCCAAACAAAATCAAGCTT
CCTCGCCTTTGGTATTGCCTCCGGTGACAGCATCGACCGTCAAACCGCTGCCACCTACTCCCCAACTGCCTACTG
GGGCCGGAGACGAAACAGATAAAGAAGATCTGGACGGAGGGGTTCAAACAGAAGGAGAGAATGATGATCTCCCTG
CTGCTCCTGCTGTTGGGCGTGGCAACGATCCAACGACACCCAAAAAGAAAACGCGAAGAGGCAAACGAGGTGCTA
AGAAAGCTAAAAATGGGACTGGAGATCCCGTACCGAATGATATGAAGATGAATGGGAAAGACGTTGTGGTAGATC
TTGGTGAAGAAGGAACGAAACTACCGAAAATGCCGAGTTCGTTGATTTTGACAAGTACTCCGAAAGCTGTAAGCG
CTCCAAAACCTTCATTGGTCGTTTCCGATAACATCCTCGGTATGTTACTTCCTCGTACCTTTCTTGTCTCTTTTA
CTAAAAGCGTTTAAGGTTACGGCTCTCATGGGACTGTGGTCTACAAGGGTTCACTCCAAGGTCGAGCAGTGGCAG
TCAAGCGTCTTTTGGCCGATTTCGTCACGCTCGCTTCTCGTGAAGTATCGATTTTACAAGAATCCGATGATCATC
CAAACGTCATTCGATACTACTATCAAGAAGCTCATGCTGGATTCCTATATATCGCTTTGGAGCTATGTCCGGCGA
GTTTGGCGGATTTGATTGAGATGCCGGATAGAGATGCCTGGAGGGATATTGCTGTTAGCTTTGACCCGAAGAGAG
CGCTGAAGCAGGTTACAAATGGCTTGAGACATTTGCATGCTTTGAAATTGGTTCATAGGGATATTAAGCCCCAGA
ATATTTTGGTTTCGACTAAGGGTGGTGGGCTCAGTGGTGCGGGGAGTGGGGGAGGCGCAGCAGCGAGGGGAACGA
ATTATCGGATGTTGATTTCGGATTTTGGGTTGTGTAAGAAATTGGATGTGGACCAGACGAGTTTTATGCCCACTG
TTCATGGGGCTATGGCTGCTGGTACTGTTGGTTGGCGTGCACCGGAGATATTACGGGGTGAAGTCAAGTTGGATG
ATGAAATGGGAGACGATCAGTCATCTCGGGGTTCTAATGCTACCATCCACGGCGGAAATCATAACTCTTCCACCC
ATTCAACGTCTTCGAGTAACTCTTCGTCCTCATCCTCGTCAAACCCTGGCAAGGGGAGACGAACGAAATTGACGA
AGAGTGTGGATATTTTTGCGTTGGGATGTTTGTATTACTATACTTTGACTGGAGGCGGTCATCCGTTTGGGGATA
GGTATGAGAGGGAAGTGAATATAATGAAGAATGAGAAGAATCTGGAGATGTTGGAGAGGTTTGGAGAGGAAGGTA
CTGAAGCTGCGGATTTGATTGAAAAAATGTTGGATCCTATACCCTCTGAACGGTACGTCATTTGCATTCATTCGT
CTTTTGAACCTTTTAATCTCAAAGTGTTTGATTTTTTTTAGCCCGGATACAACGTCGTGTCTGTTACATCCATTT
TTCTGGGACTGTTCAAGACGATTAAATTTCTTGCAAGAAGCATCGGATCGATTTGAATTCATGTGTAGGGATCCG
AAAGATCCTGATCTATTAGCTTTGGAGGAGAATGTGCAGGGTATAATTGGGAATGATTGGCATTTGAGGATGGAT
AGATTGTTTATTGAGAATTTGGGGAAATATAGGAAGTATGATGGGAGGAGTGTACAAGATTTGTTGAGAGCTTTG
AGGAATAAGGTCCGTTCTCTCTTACTTTTACTGCTCTACATTACAACTCGTTGACGGTACTACGTGCGGCGCTTT
TACAGAAACATCATTATCAAGATTTACCGGATAATGTCAAACGGCATTTAGGACCTATGCCGGAAGGGTTCCTGG
CGTATTTCACGAGAAGATTTCCGAGATTGTTTTTGCATGTACATCGAGTGGTGAGAGAAACGGGGCTTGCCAATG
AATCGGTTTTTAGAAGTTATTTCGAGTTGCCGGATTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail