Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|115060
Gene name
Locationscaffold_09:505568..506158
Strand-
Gene length (bp)590
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 7.4E-19 62 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52748|HYP1_PISTI Hydrophobin-1 OS=Pisolithus tinctorius GN=HYD-1 PE=2 SV=1 23 139 5.0E-25
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 47 135 2.0E-15
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 62 135 1.0E-13
sp|P16934|SC4_SCHCO Fruiting body protein SC4 OS=Schizophyllum commune GN=SC4 PE=2 SV=1 52 137 5.0E-13
sp|O43122|HYP4_AGABI Hydrophobin-B OS=Agaricus bisporus GN=hypB PE=3 SV=1 62 135 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52748|HYP1_PISTI Hydrophobin-1 OS=Pisolithus tinctorius GN=HYD-1 PE=2 SV=1 23 139 5.0E-25
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 47 135 2.0E-15
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 62 135 1.0E-13
sp|P16934|SC4_SCHCO Fruiting body protein SC4 OS=Schizophyllum commune GN=SC4 PE=2 SV=1 52 137 5.0E-13
sp|O43122|HYP4_AGABI Hydrophobin-B OS=Agaricus bisporus GN=hypB PE=3 SV=1 62 135 5.0E-12
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 65 135 5.0E-10
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 62 132 2.0E-09
sp|P49073|HYP2_AGABI Hydrophobin-2 OS=Agaricus bisporus GN=hypC PE=3 SV=2 52 138 2.0E-09
sp|P52749|HYP2_PISTI Hydrophobin-2 (Fragment) OS=Pisolithus tinctorius GN=HYD-2 PE=2 SV=1 62 139 2.0E-08
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 54 138 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005199 structural constituent of cell wall Yes
GO:0009277 fungal-type cell wall Yes
GO:0005198 structural molecule activity No
GO:0030312 external encapsulating structure No
GO:0005618 cell wall No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|115060
MKFNTVFTFITLSAASVYAANYETNASRLARGLPPLPPTRRTSSWGAKRAQPSGVPSNISGCNSGQVQCCNTVMN
SADSNANTLMDLLNMASPVTNLIGLNCSPLGTGGNRCTSQPLCCENNSSNGLVSTGCTPIVLNA*
Coding >Agabi119p4|115060
ATGAAGTTCAACACCGTCTTTACCTTCATTACTCTCAGTGCTGCTAGTGTCTATGCCGCCAATTATGAGACCAAT
GCTTCTCGCCTCGCTCGTGGTCTACCTCCTCTTCCTCCTACCCGCCGTACCAGCTCTTGGGGTGCTAAACGTGCT
CAACCTTCCGGCGTCCCGAGTAACATTAGCGGCTGTAACTCCGGTCAAGTACAATGTTGCAACACCGTCATGAAT
TCAGCAGATTCAAATGCCAATACCCTCATGGATCTCTTGAATATGGCCTCTCCCGTAACAAACCTCATTGGTCTC
AACTGCAGTCCTCTCGGTACCGGTGGCAATAGGTGTACCAGCCAACCACTATGCTGCGAGAACAATTCATCCAAT
GGTCTCGTTTCTACCGGCTGCACGCCTATCGTCCTCAACGCCTAA
Transcript >Agabi119p4|115060
ATGAAGTTCAACACCGTCTTTACCTTCATTACTCTCAGTGCTGCTAGTGTCTATGCCGCCAATTATGAGACCAAT
GCTTCTCGCCTCGCTCGTGGTCTACCTCCTCTTCCTCCTACCCGCCGTACCAGCTCTTGGGGTGCTAAACGTGCT
CAACCTTCCGGCGTCCCGAGTAACATTAGCGGCTGTAACTCCGGTCAAGTACAATGTTGCAACACCGTCATGAAT
TCAGCAGATTCAAATGCCAATACCCTCATGGATCTCTTGAATATGGCCTCTCCCGTAACAAACCTCATTGGTCTC
AACTGCAGTCCTCTCGGTACCGGTGGCAATAGGTGTACCAGCCAACCACTATGCTGCGAGAACAATTCATCCAAT
GGTCTCGTTTCTACCGGCTGCACGCCTATCGTCCTCAACGCCTAA
Gene >Agabi119p4|115060
ATGAAGTTCAACACCGTCTTTACCTTCATTACTCTCAGTGCTGCTAGTGTCTATGCCGCCAATTATGAGACCAAT
GCTTCTCGCCTCGCTCGTGGTCTACCTCCTCTTCCTCCTACCCGCCGTACCAGCTCTTGGGGTAAGTCAGCGGTG
ACCCCCAGGAGCAGTTAGATTCTTACGACTCTTTTCTCATAGGTGCTAAACGTGCTCAACCTTCCGGCGTCCCGA
GTAACATTAGCGGCTGTAACTCCGGTCAAGTACAATGTTGCAACACCGTCATGAATTCAGCAGATTCAAATGCCA
ATACCCTCATGGATCTCTTGAATATGGCCTCTCCCGTAACAAACCTCATTGGTCTCAACTGCAGTCCTCTCGGTA
CCGGTGGCAATAGGTGGTAAGTGCGTTCATCAATCTTCGACGACCTCGATTGTCAATATTCTCCCATCCAACTAG
TACCAGCCAACCACTATGCTGCGAGAACAATTCATCCAATGGTCTCGTTTCTACCGGCTGCACGCCTAGTGAGTA
TAATTCCTGTCATGTATATGCGTCTTTGGCTGACTGACATCGCACTAGTCGTCCTCAACGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail