Protein ID | Agabi119p4|114950 |
Gene name | |
Location | scaffold_09:479404..480596 |
Strand | - |
Gene length (bp) | 1192 |
Transcript length (bp) | 915 |
Coding sequence length (bp) | 915 |
Protein length (aa) | 305 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00231 | ATP-synt | ATP synthase | 3.6E-78 | 29 | 304 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O74754|ATPG_SCHPO | ATP synthase subunit gamma, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp3 PE=3 SV=1 | 28 | 304 | 2.0E-83 |
sp|P49377|ATPG_KLULA | ATP synthase subunit gamma, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP3 PE=1 SV=1 | 24 | 304 | 6.0E-81 |
sp|P38077|ATPG_YEAST | ATP synthase subunit gamma, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP3 PE=1 SV=1 | 25 | 304 | 3.0E-72 |
sp|O01666|ATPG_DROME | ATP synthase subunit gamma, mitochondrial OS=Drosophila melanogaster GN=ATPsyngamma PE=2 SV=2 | 3 | 304 | 1.0E-70 |
sp|P05631|ATPG_BOVIN | ATP synthase subunit gamma, mitochondrial OS=Bos taurus GN=ATP5C1 PE=1 SV=3 | 9 | 304 | 1.0E-70 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O74754|ATPG_SCHPO | ATP synthase subunit gamma, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp3 PE=3 SV=1 | 28 | 304 | 2.0E-83 |
sp|P49377|ATPG_KLULA | ATP synthase subunit gamma, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP3 PE=1 SV=1 | 24 | 304 | 6.0E-81 |
sp|P38077|ATPG_YEAST | ATP synthase subunit gamma, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP3 PE=1 SV=1 | 25 | 304 | 3.0E-72 |
sp|O01666|ATPG_DROME | ATP synthase subunit gamma, mitochondrial OS=Drosophila melanogaster GN=ATPsyngamma PE=2 SV=2 | 3 | 304 | 1.0E-70 |
sp|P05631|ATPG_BOVIN | ATP synthase subunit gamma, mitochondrial OS=Bos taurus GN=ATP5C1 PE=1 SV=3 | 9 | 304 | 1.0E-70 |
sp|Q91VR2|ATPG_MOUSE | ATP synthase subunit gamma, mitochondrial OS=Mus musculus GN=Atp5c1 PE=1 SV=1 | 9 | 304 | 3.0E-68 |
sp|P36542|ATPG_HUMAN | ATP synthase subunit gamma, mitochondrial OS=Homo sapiens GN=ATP5C1 PE=1 SV=1 | 23 | 304 | 6.0E-68 |
sp|Q4R5B0|ATPG_MACFA | ATP synthase subunit gamma, mitochondrial OS=Macaca fascicularis GN=ATP5C1 PE=2 SV=1 | 23 | 304 | 1.0E-67 |
sp|Q5RBS9|ATPG_PONAB | ATP synthase subunit gamma, mitochondrial OS=Pongo abelii GN=ATP5C1 PE=2 SV=1 | 23 | 304 | 1.0E-67 |
sp|P35435|ATPG_RAT | ATP synthase subunit gamma, mitochondrial OS=Rattus norvegicus GN=Atp5c1 PE=1 SV=2 | 28 | 304 | 4.0E-64 |
sp|P26360|ATPG3_IPOBA | ATP synthase subunit gamma, mitochondrial OS=Ipomoea batatas GN=ATPC PE=1 SV=2 | 13 | 304 | 1.0E-48 |
sp|Q162S8|ATPG_ROSDO | ATP synthase gamma chain OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-45 |
sp|Q96250|ATPG3_ARATH | ATP synthase subunit gamma, mitochondrial OS=Arabidopsis thaliana GN=ATPC PE=2 SV=1 | 36 | 304 | 6.0E-45 |
sp|Q2VZN1|ATPG_MAGSA | ATP synthase gamma chain OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-45 |
sp|B6IPC7|ATPG_RHOCS | ATP synthase gamma chain OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-44 |
sp|A8LJR5|ATPG_DINSH | ATP synthase gamma chain OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-44 |
sp|P05436|ATPG_RHOBL | ATP synthase gamma chain OS=Rhodobacter blasticus GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-43 |
sp|Q54DF1|ATPG_DICDI | ATP synthase subunit gamma, mitochondrial OS=Dictyostelium discoideum GN=atp5C1 PE=1 SV=1 | 18 | 304 | 2.0E-42 |
sp|Q28TJ7|ATPG_JANSC | ATP synthase gamma chain OS=Jannaschia sp. (strain CCS1) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-41 |
sp|Q4FP37|ATPG_PELUB | ATP synthase gamma chain OS=Pelagibacter ubique (strain HTCC1062) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-41 |
sp|A1B8N9|ATPG_PARDP | ATP synthase gamma chain OS=Paracoccus denitrificans (strain Pd 1222) GN=atpG PE=1 SV=1 | 27 | 304 | 4.0E-40 |
sp|B9KPI7|ATPG_RHOSK | ATP synthase gamma chain OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-40 |
sp|A3PIB8|ATPG_RHOS1 | ATP synthase gamma chain OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-40 |
sp|Q3J432|ATPG_RHOS4 | ATP synthase gamma chain OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-39 |
sp|A4WUM8|ATPG_RHOS5 | ATP synthase gamma chain OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-39 |
sp|Q1GEU7|ATPG_RUEST | ATP synthase gamma chain OS=Ruegeria sp. (strain TM1040) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-38 |
sp|B9LZ85|ATPG_GEODF | ATP synthase gamma chain OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-38 |
sp|P29710|ATPG_PROMO | ATP synthase gamma chain, sodium ion specific OS=Propionigenium modestum GN=atpG PE=1 SV=2 | 27 | 304 | 7.0E-38 |
sp|A5V3X4|ATPG_SPHWW | ATP synthase gamma chain OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-37 |
sp|Q39Q55|ATPG_GEOMG | ATP synthase gamma chain OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-36 |
sp|B3EA02|ATPG_GEOLS | ATP synthase gamma chain OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-36 |
sp|B1I6J8|ATPG_DESAP | ATP synthase gamma chain OS=Desulforudis audaxviator (strain MP104C) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-36 |
sp|B8FZ35|ATPG_DESHD | ATP synthase gamma chain OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-36 |
sp|B4RD46|ATPG_PHEZH | ATP synthase gamma chain OS=Phenylobacterium zucineum (strain HLK1) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-35 |
sp|A6TK64|ATPG_ALKMQ | ATP synthase gamma chain OS=Alkaliphilus metalliredigens (strain QYMF) GN=atpG PE=3 SV=1 | 30 | 304 | 3.0E-35 |
sp|Q74GY1|ATPG_GEOSL | ATP synthase gamma chain OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-35 |
sp|Q0BQE7|ATPG_GRABC | ATP synthase gamma chain OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-34 |
sp|P07227|ATPG_RHORU | ATP synthase gamma chain OS=Rhodospirillum rubrum GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-34 |
sp|Q2RV19|ATPG_RHORT | ATP synthase gamma chain OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-34 |
sp|Q6G1W8|ATPG_BARHE | ATP synthase gamma chain OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-34 |
sp|Q9A2V8|ATPG_CAUCR | ATP synthase gamma chain OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-34 |
sp|B8H5I1|ATPG_CAUCN | ATP synthase gamma chain OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-34 |
sp|B5ER43|ATPG_ACIF5 | ATP synthase gamma chain OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-34 |
sp|B7JB85|ATPG_ACIF2 | ATP synthase gamma chain OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-34 |
sp|A5CYE3|ATPG_PELTS | ATP synthase gamma chain OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-34 |
sp|A5FZ53|ATPG_ACICJ | ATP synthase gamma chain OS=Acidiphilium cryptum (strain JF-5) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-34 |
sp|A6UDM2|ATPG_SINMW | ATP synthase gamma chain OS=Sinorhizobium medicae (strain WSM419) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-34 |
sp|Q5LNP0|ATPG_RUEPO | ATP synthase gamma chain OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-34 |
sp|A7HT51|ATPG_PARL1 | ATP synthase gamma chain OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-34 |
sp|Q5WSG7|ATPG_LEGPL | ATP synthase gamma chain OS=Legionella pneumophila (strain Lens) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-34 |
sp|Q5ZRA0|ATPG_LEGPH | ATP synthase gamma chain OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-34 |
sp|A5III4|ATPG_LEGPC | ATP synthase gamma chain OS=Legionella pneumophila (strain Corby) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-34 |
sp|Q5X0P2|ATPG_LEGPA | ATP synthase gamma chain OS=Legionella pneumophila (strain Paris) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-34 |
sp|A1UR48|ATPG_BARBK | ATP synthase gamma chain OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-34 |
sp|B0THN3|ATPG_HELMI | ATP synthase gamma chain OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-33 |
sp|C3M9S2|ATPG_RHISN | ATP synthase gamma chain OS=Rhizobium sp. (strain NGR234) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-33 |
sp|Q9HT19|ATPG_PSEAE | ATP synthase gamma chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-33 |
sp|Q02DF3|ATPG_PSEAB | ATP synthase gamma chain OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-33 |
sp|B7V792|ATPG_PSEA8 | ATP synthase gamma chain OS=Pseudomonas aeruginosa (strain LESB58) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-33 |
sp|A6VF33|ATPG_PSEA7 | ATP synthase gamma chain OS=Pseudomonas aeruginosa (strain PA7) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-33 |
sp|B8F773|ATPG_HAEPS | ATP synthase gamma chain OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-33 |
sp|A5G9D7|ATPG_GEOUR | ATP synthase gamma chain OS=Geobacter uraniireducens (strain Rf4) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-33 |
sp|Q48AW1|ATPG_COLP3 | ATP synthase gamma chain OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-33 |
sp|Q6LLG7|ATPG1_PHOPR | ATP synthase gamma chain 1 OS=Photobacterium profundum GN=atpG1 PE=3 SV=1 | 27 | 304 | 2.0E-33 |
sp|A4J9A0|ATPG_DESRM | ATP synthase gamma chain OS=Desulfotomaculum reducens (strain MI-1) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-33 |
sp|A6WXX0|ATPG_OCHA4 | ATP synthase gamma chain OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-33 |
sp|B0T336|ATPG_CAUSK | ATP synthase gamma chain OS=Caulobacter sp. (strain K31) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-33 |
sp|P72246|ATPG_RHOCA | ATP synthase gamma chain OS=Rhodobacter capsulatus GN=atpG PE=1 SV=3 | 27 | 304 | 6.0E-33 |
sp|Q5NQZ0|ATPG_ZYMMO | ATP synthase gamma chain OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-33 |
sp|Q1CX34|ATPG_MYXXD | ATP synthase gamma chain OS=Myxococcus xanthus (strain DK 1622) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-33 |
sp|Q2N8Z4|ATPG_ERYLH | ATP synthase gamma chain OS=Erythrobacter litoralis (strain HTCC2594) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-33 |
sp|B1HM55|ATPG_LYSSC | ATP synthase gamma chain OS=Lysinibacillus sphaericus (strain C3-41) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-33 |
sp|B2ICI6|ATPG_BEII9 | ATP synthase gamma chain OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-32 |
sp|O05432|ATPG_MOOTA | ATP synthase gamma chain OS=Moorella thermoacetica (strain ATCC 39073) GN=atpG PE=1 SV=2 | 27 | 304 | 1.0E-32 |
sp|Q2JIG1|ATPG_SYNJB | ATP synthase gamma chain OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-32 |
sp|Q7MGH9|ATPG_VIBVY | ATP synthase gamma chain OS=Vibrio vulnificus (strain YJ016) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-32 |
sp|Q8DDG9|ATPG_VIBVU | ATP synthase gamma chain OS=Vibrio vulnificus (strain CMCP6) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-32 |
sp|Q87KA7|ATPG_VIBPA | ATP synthase gamma chain OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-32 |
sp|P12990|ATPG_VIBAL | ATP synthase gamma chain OS=Vibrio alginolyticus GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-32 |
sp|Q5FRC6|ATPG_GLUOX | ATP synthase gamma chain OS=Gluconobacter oxydans (strain 621H) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-32 |
sp|C0Z777|ATPG_BREBN | ATP synthase gamma chain OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=atpG PE=3 SV=1 | 30 | 303 | 5.0E-32 |
sp|P41169|ATPG_ACIFR | ATP synthase gamma chain OS=Acidithiobacillus ferrooxidans GN=atpG PE=3 SV=1 | 27 | 302 | 7.0E-32 |
sp|B9JTR3|ATPG_AGRVS | ATP synthase gamma chain OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-32 |
sp|Q0SQZ4|ATPG_CLOPS | ATP synthase gamma chain OS=Clostridium perfringens (strain SM101 / Type A) GN=atpG PE=3 SV=1 | 28 | 303 | 1.0E-31 |
sp|Q8XID3|ATPG_CLOPE | ATP synthase gamma chain OS=Clostridium perfringens (strain 13 / Type A) GN=atpG PE=3 SV=1 | 28 | 303 | 1.0E-31 |
sp|Q0TNC3|ATPG_CLOP1 | ATP synthase gamma chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=atpG PE=3 SV=1 | 28 | 303 | 1.0E-31 |
sp|Q21DK7|ATPG_SACD2 | ATP synthase gamma chain OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-31 |
sp|Q2JSW2|ATPG_SYNJA | ATP synthase gamma chain OS=Synechococcus sp. (strain JA-3-3Ab) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-31 |
sp|B8I578|ATPG_CLOCE | ATP synthase gamma chain OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=atpG PE=3 SV=1 | 30 | 304 | 1.0E-31 |
sp|B6J2D9|ATPG_COXB2 | ATP synthase gamma chain OS=Coxiella burnetii (strain CbuG_Q212) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-31 |
sp|Q83AF6|ATPG_COXBU | ATP synthase gamma chain OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-31 |
sp|A9NBC9|ATPG_COXBR | ATP synthase gamma chain OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-31 |
sp|A9KBF8|ATPG_COXBN | ATP synthase gamma chain OS=Coxiella burnetii (strain Dugway 5J108-111) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-31 |
sp|Q1MAZ1|ATPG_RHIL3 | ATP synthase gamma chain OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-31 |
sp|B6J962|ATPG_COXB1 | ATP synthase gamma chain OS=Coxiella burnetii (strain CbuK_Q154) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-31 |
sp|Q15MU3|ATPG_PSEA6 | ATP synthase gamma chain OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-31 |
sp|Q0C0Z9|ATPG_HYPNA | ATP synthase gamma chain OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-31 |
sp|B5ZSN8|ATPG_RHILW | ATP synthase gamma chain OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-31 |
sp|C6E9F2|ATPG_GEOSM | ATP synthase gamma chain OS=Geobacter sp. (strain M21) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|Q6FYM2|ATPG_BARQU | ATP synthase gamma chain OS=Bartonella quintana (strain Toulouse) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|Q0VKX3|ATPG_ALCBS | ATP synthase gamma chain OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|A5FRQ4|ATPG_DEHMB | ATP synthase gamma chain OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|B1ZEE8|ATPG_METPB | ATP synthase gamma chain OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|Q8FYR4|ATPG_BRUSU | ATP synthase gamma chain OS=Brucella suis biovar 1 (strain 1330) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|A9WWS3|ATPG_BRUSI | ATP synthase gamma chain OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|A5VSE2|ATPG_BRUO2 | ATP synthase gamma chain OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|Q5KUJ2|ATPG_GEOKA | ATP synthase gamma chain OS=Geobacillus kaustophilus (strain HTA426) GN=atpG PE=1 SV=1 | 27 | 304 | 3.0E-31 |
sp|Q8VV78|ATPG_COLMA | ATP synthase gamma chain OS=Colwellia maris GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|Q92LK7|ATPG_RHIME | ATP synthase gamma chain OS=Rhizobium meliloti (strain 1021) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|A0LDA1|ATPG_MAGMM | ATP synthase gamma chain OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|C5D991|ATPG_GEOSW | ATP synthase gamma chain OS=Geobacillus sp. (strain WCH70) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-31 |
sp|A7GV57|ATPG_BACCN | ATP synthase gamma chain OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-31 |
sp|B5EFI8|ATPG_GEOBB | ATP synthase gamma chain OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-31 |
sp|P20602|ATPG_BACMQ | ATP synthase gamma chain OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-31 |
sp|B9JBZ6|ATPG_AGRRK | ATP synthase gamma chain OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-31 |
sp|A9M838|ATPG_BRUC2 | ATP synthase gamma chain OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-31 |
sp|Q89X73|ATPG_BRADU | ATP synthase gamma chain OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-31 |
sp|A1WZT2|ATPG_HALHL | ATP synthase gamma chain OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-31 |
sp|B7KUA3|ATPG_METC4 | ATP synthase gamma chain OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-31 |
sp|Q3J6N0|ATPG_NITOC | ATP synthase gamma chain OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-31 |
sp|B4F0E6|ATPG_PROMH | ATP synthase gamma chain OS=Proteus mirabilis (strain HI4320) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-31 |
sp|B4SGC6|ATPG_PELPB | ATP synthase gamma chain OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-31 |
sp|B3PQ69|ATPG_RHIE6 | ATP synthase gamma chain OS=Rhizobium etli (strain CIAT 652) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-31 |
sp|Q2LQZ6|ATPG_SYNAS | ATP synthase gamma chain OS=Syntrophus aciditrophicus (strain SB) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-31 |
sp|Q8YJ36|ATPG_BRUME | ATP synthase gamma chain OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-31 |
sp|C0RF51|ATPG_BRUMB | ATP synthase gamma chain OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-31 |
sp|Q57B87|ATPG_BRUAB | ATP synthase gamma chain OS=Brucella abortus biovar 1 (strain 9-941) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-31 |
sp|Q2YLI6|ATPG_BRUA2 | ATP synthase gamma chain OS=Brucella abortus (strain 2308) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-31 |
sp|B2S7M4|ATPG_BRUA1 | ATP synthase gamma chain OS=Brucella abortus (strain S19) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-31 |
sp|A0Q2Z5|ATPG_CLONN | ATP synthase gamma chain OS=Clostridium novyi (strain NT) GN=atpG PE=3 SV=1 | 28 | 303 | 8.0E-31 |
sp|Q3A945|ATPG_CARHZ | ATP synthase gamma chain OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-31 |
sp|A9IYW8|ATPG_BART1 | ATP synthase gamma chain OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-31 |
sp|B9DME4|ATPG_STACT | ATP synthase gamma chain OS=Staphylococcus carnosus (strain TM300) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-31 |
sp|Q88BX3|ATPG_PSEPK | ATP synthase gamma chain OS=Pseudomonas putida (strain KT2440) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-31 |
sp|A5WBA4|ATPG_PSEP1 | ATP synthase gamma chain OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-31 |
sp|Q1GXM9|ATPG_METFK | ATP synthase gamma chain OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-31 |
sp|Q0A4M7|ATPG_ALKEH | ATP synthase gamma chain OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-31 |
sp|Q02BU2|ATPG_SOLUE | ATP synthase gamma chain OS=Solibacter usitatus (strain Ellin6076) GN=atpG PE=3 SV=1 | 27 | 303 | 1.0E-30 |
sp|A7IH30|ATPG_XANP2 | ATP synthase gamma chain OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-30 |
sp|Q4K3A8|ATPG_PSEF5 | ATP synthase gamma chain OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-30 |
sp|A8HS13|ATPG_AZOC5 | ATP synthase gamma chain OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-30 |
sp|Q1I2I6|ATPG_PSEE4 | ATP synthase gamma chain OS=Pseudomonas entomophila (strain L48) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-30 |
sp|C4KYS4|ATPG_EXISA | ATP synthase gamma chain OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-30 |
sp|A4Y188|ATPG_PSEMY | ATP synthase gamma chain OS=Pseudomonas mendocina (strain ymp) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-30 |
sp|Q3ZZT8|ATPG_DEHMC | ATP synthase gamma chain OS=Dehalococcoides mccartyi (strain CBDB1) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-30 |
sp|B1JFU2|ATPG_PSEPW | ATP synthase gamma chain OS=Pseudomonas putida (strain W619) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-30 |
sp|A7HIX8|ATPG_ANADF | ATP synthase gamma chain OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-30 |
sp|Q5E1N6|ATPG_VIBF1 | ATP synthase gamma chain OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-30 |
sp|Q1QQS6|ATPG_NITHX | ATP synthase gamma chain OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-30 |
sp|Q2GGH2|ATPG_EHRCR | ATP synthase gamma chain OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|P22482|ATPG_BACPE | ATP synthase gamma chain OS=Bacillus pseudofirmus (strain OF4) GN=atpG PE=3 SV=2 | 27 | 304 | 3.0E-30 |
sp|C3LSJ0|ATPG_VIBCM | ATP synthase gamma chain OS=Vibrio cholerae serotype O1 (strain M66-2) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|Q9KNH4|ATPG_VIBCH | ATP synthase gamma chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|A5F458|ATPG_VIBC3 | ATP synthase gamma chain OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|A1JTC7|ATPG_YERE8 | ATP synthase gamma chain OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|Q7NA93|ATPG_PHOLL | ATP synthase gamma chain OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|B1JRN1|ATPG_YERPY | ATP synthase gamma chain OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|Q663Q7|ATPG_YERPS | ATP synthase gamma chain OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|A4TSJ2|ATPG_YERPP | ATP synthase gamma chain OS=Yersinia pestis (strain Pestoides F) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|Q1CCH4|ATPG_YERPN | ATP synthase gamma chain OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|A9R5U0|ATPG_YERPG | ATP synthase gamma chain OS=Yersinia pestis bv. Antiqua (strain Angola) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|Q8Z9S5|ATPG_YERPE | ATP synthase gamma chain OS=Yersinia pestis GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|B2K846|ATPG_YERPB | ATP synthase gamma chain OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|Q1C094|ATPG_YERPA | ATP synthase gamma chain OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|A7FPE1|ATPG_YERP3 | ATP synthase gamma chain OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-30 |
sp|Q2IHQ1|ATPG_ANADE | ATP synthase gamma chain OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|B5FCZ2|ATPG_VIBFM | ATP synthase gamma chain OS=Vibrio fischeri (strain MJ11) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|Q8UC75|ATPG_AGRFC | ATP synthase gamma chain OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|A8EV71|ATPG_ARCB4 | ATP synthase gamma chain OS=Arcobacter butzleri (strain RM4018) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|A9KK93|ATPG_CLOPH | ATP synthase gamma chain OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|Q2S6P0|ATPG_HAHCH | ATP synthase gamma chain OS=Hahella chejuensis (strain KCTC 2396) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|Q21CY6|ATPG_RHOPB | ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain BisB18) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|B4SJS0|ATPG_STRM5 | ATP synthase gamma chain OS=Stenotrophomonas maltophilia (strain R551-3) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|A8G1W6|ATPG_SHESH | ATP synthase gamma chain OS=Shewanella sediminis (strain HAW-EB3) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|Q11DD6|ATPG_CHESB | ATP synthase gamma chain OS=Chelativorans sp. (strain BNC1) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-30 |
sp|Q5H4Y5|ATPG_XANOR | ATP synthase gamma chain OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-30 |
sp|B2SQB1|ATPG_XANOP | ATP synthase gamma chain OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-30 |
sp|Q2P7Q5|ATPG_XANOM | ATP synthase gamma chain OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-30 |
sp|B8IN02|ATPG_METNO | ATP synthase gamma chain OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-30 |
sp|A1RQB1|ATPG_SHESW | ATP synthase gamma chain OS=Shewanella sp. (strain W3-18-1) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-30 |
sp|A4YCH9|ATPG_SHEPC | ATP synthase gamma chain OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-30 |
sp|Q3YS74|ATPG_EHRCJ | ATP synthase gamma chain OS=Ehrlichia canis (strain Jake) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-30 |
sp|B2FHY9|ATPG_STRMK | ATP synthase gamma chain OS=Stenotrophomonas maltophilia (strain K279a) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-30 |
sp|C4LDW1|ATPG_TOLAT | ATP synthase gamma chain OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-30 |
sp|P09222|ATPG_BACP3 | ATP synthase gamma chain OS=Bacillus sp. (strain PS3) GN=atpG PE=1 SV=1 | 27 | 304 | 7.0E-30 |
sp|Q07UZ4|ATPG_RHOP5 | ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain BisA53) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-30 |
sp|A2SC69|ATPG_METPP | ATP synthase gamma chain OS=Methylibium petroleiphilum (strain PM1) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-30 |
sp|Q3SVJ3|ATPG_NITWN | ATP synthase gamma chain OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-30 |
sp|Q60CR5|ATPG_METCA | ATP synthase gamma chain OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-30 |
sp|A9W2R2|ATPG_METEP | ATP synthase gamma chain OS=Methylobacterium extorquens (strain PA1) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-30 |
sp|Q5P4E3|ATPG_AROAE | ATP synthase gamma chain OS=Aromatoleum aromaticum (strain EbN1) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-30 |
sp|Q4QN63|ATPG_HAEI8 | ATP synthase gamma chain OS=Haemophilus influenzae (strain 86-028NP) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|B0VBP4|ATPG_ACIBY | ATP synthase gamma chain OS=Acinetobacter baumannii (strain AYE) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|A3M143|ATPG_ACIBT | ATP synthase gamma chain OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=atpG PE=3 SV=2 | 27 | 304 | 1.0E-29 |
sp|B0VNK3|ATPG_ACIBS | ATP synthase gamma chain OS=Acinetobacter baumannii (strain SDF) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|B2I101|ATPG_ACIBC | ATP synthase gamma chain OS=Acinetobacter baumannii (strain ACICU) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|B7H295|ATPG_ACIB3 | ATP synthase gamma chain OS=Acinetobacter baumannii (strain AB307-0294) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|B1YMR5|ATPG_EXIS2 | ATP synthase gamma chain OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=atpG PE=3 SV=1 | 27 | 303 | 1.0E-29 |
sp|A4STP4|ATPG_AERS4 | ATP synthase gamma chain OS=Aeromonas salmonicida (strain A449) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|Q46VX9|ATPG_CUPPJ | ATP synthase gamma chain OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|A4SGM8|ATPG_CHLPM | ATP synthase gamma chain OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|Q0AJB1|ATPG_NITEC | ATP synthase gamma chain OS=Nitrosomonas eutropha (strain C91) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|B8GRB9|ATPG_THISH | ATP synthase gamma chain OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|B0UE40|ATPG_METS4 | ATP synthase gamma chain OS=Methylobacterium sp. (strain 4-46) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|B0KRA9|ATPG_PSEPG | ATP synthase gamma chain OS=Pseudomonas putida (strain GB-1) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|Q2J3I3|ATPG_RHOP2 | ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain HaA2) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|A5UA10|ATPG_HAEIE | ATP synthase gamma chain OS=Haemophilus influenzae (strain PittEE) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-29 |
sp|Q8PGG6|ATPG_XANAC | ATP synthase gamma chain OS=Xanthomonas axonopodis pv. citri (strain 306) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q6FFK1|ATPG_ACIAD | ATP synthase gamma chain OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|B9E8E7|ATPG_MACCJ | ATP synthase gamma chain OS=Macrococcus caseolyticus (strain JCSC5402) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|O50141|ATPG_RUMA7 | ATP synthase gamma chain OS=Ruminococcus albus (strain ATCC 27210 / DSM 20455 / JCM 14654 / NCDO 2250 / 7) GN=atpG PE=3 SV=1 | 27 | 297 | 2.0E-29 |
sp|B7K5I9|ATPG_CYAP8 | ATP synthase gamma chain OS=Cyanothece sp. (strain PCC 8801) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q9L6B6|ATPG_PASMU | ATP synthase gamma chain OS=Pasteurella multocida (strain Pm70) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q0AKV9|ATPG_MARMM | ATP synthase gamma chain OS=Maricaulis maris (strain MCS10) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q1QSC9|ATPG_CHRSD | ATP synthase gamma chain OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q8PCZ6|ATPG_XANCP | ATP synthase gamma chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|B0RWC3|ATPG_XANCB | ATP synthase gamma chain OS=Xanthomonas campestris pv. campestris (strain B100) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q4UQF3|ATPG_XANC8 | ATP synthase gamma chain OS=Xanthomonas campestris pv. campestris (strain 8004) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q12GQ1|ATPG_POLSJ | ATP synthase gamma chain OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q4ZL23|ATPG_PSEU2 | ATP synthase gamma chain OS=Pseudomonas syringae pv. syringae (strain B728a) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q48BG4|ATPG_PSE14 | ATP synthase gamma chain OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|Q7P096|ATPG_CHRVO | ATP synthase gamma chain OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=atpG PE=3 SV=2 | 27 | 304 | 2.0E-29 |
sp|A8G7M7|ATPG_SERP5 | ATP synthase gamma chain OS=Serratia proteamaculans (strain 568) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-29 |
sp|B6EHG5|ATPG_ALISL | ATP synthase gamma chain OS=Aliivibrio salmonicida (strain LFI1238) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-29 |
sp|A1T0Z0|ATPG_PSYIN | ATP synthase gamma chain OS=Psychromonas ingrahamii (strain 37) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-29 |
sp|Q11YP0|ATPG_CYTH3 | ATP synthase gamma chain OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-29 |
sp|Q3BP14|ATPG_XANC5 | ATP synthase gamma chain OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-29 |
sp|Q2S431|ATPG_SALRD | ATP synthase gamma chain OS=Salinibacter ruber (strain DSM 13855 / M31) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-29 |
sp|B1XSD3|ATPG_POLNS | ATP synthase gamma chain OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-29 |
sp|P43716|ATPG_HAEIN | ATP synthase gamma chain OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-29 |
sp|Q1LHK9|ATPG_CUPMC | ATP synthase gamma chain OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-29 |
sp|B2JJ96|ATPG_BURP8 | ATP synthase gamma chain OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-29 |
sp|Q5WB77|ATPG_BACSK | ATP synthase gamma chain OS=Bacillus clausii (strain KSM-K16) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-29 |
sp|B2VCA5|ATPG_ERWT9 | ATP synthase gamma chain OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-29 |
sp|Q13DP3|ATPG_RHOPS | ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain BisB5) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-29 |
sp|A4SUT3|ATPG_POLSQ | ATP synthase gamma chain OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-29 |
sp|A5N3H8|ATPG_CLOK5 | ATP synthase gamma chain OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=atpG PE=3 SV=1 | 28 | 304 | 4.0E-29 |
sp|B9DX62|ATPG_CLOK1 | ATP synthase gamma chain OS=Clostridium kluyveri (strain NBRC 12016) GN=atpG PE=3 SV=1 | 28 | 304 | 4.0E-29 |
sp|Q87TT3|ATPG_PSESM | ATP synthase gamma chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-29 |
sp|A0KQX9|ATPG_AERHH | ATP synthase gamma chain OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-29 |
sp|Q3K440|ATPG_PSEPF | ATP synthase gamma chain OS=Pseudomonas fluorescens (strain Pf0-1) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-29 |
sp|Q2G5N6|ATPG_NOVAD | ATP synthase gamma chain OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-29 |
sp|B3Q746|ATPG_RHOPT | ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain TIE-1) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-29 |
sp|Q6NDD1|ATPG_RHOPA | ATP synthase gamma chain OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-29 |
sp|Q2ST35|ATPG_MYCCT | ATP synthase gamma chain OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=atpG PE=3 SV=1 | 27 | 302 | 7.0E-29 |
sp|A9H9A6|ATPG_GLUDA | ATP synthase gamma chain OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-29 |
sp|Q6F203|ATPG_MESFL | ATP synthase gamma chain OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-29 |
sp|Q6CYJ4|ATPG_PECAS | ATP synthase gamma chain OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-29 |
sp|A5UGZ0|ATPG_HAEIG | ATP synthase gamma chain OS=Haemophilus influenzae (strain PittGG) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-29 |
sp|Q0K5M6|ATPG_CUPNH | ATP synthase gamma chain OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-29 |
sp|Q6HAX9|ATPG_BACHK | ATP synthase gamma chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|Q630U2|ATPG_BACCZ | ATP synthase gamma chain OS=Bacillus cereus (strain ZK / E33L) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|Q814W1|ATPG_BACCR | ATP synthase gamma chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|B7HY65|ATPG_BACC7 | ATP synthase gamma chain OS=Bacillus cereus (strain AH187) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|B7HFK2|ATPG_BACC4 | ATP synthase gamma chain OS=Bacillus cereus (strain B4264) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|C1F0M9|ATPG_BACC3 | ATP synthase gamma chain OS=Bacillus cereus (strain 03BB102) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|Q72XE7|ATPG_BACC1 | ATP synthase gamma chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|B7JGN1|ATPG_BACC0 | ATP synthase gamma chain OS=Bacillus cereus (strain AH820) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|Q81JZ4|ATPG_BACAN | ATP synthase gamma chain OS=Bacillus anthracis GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|A0RL96|ATPG_BACAH | ATP synthase gamma chain OS=Bacillus thuringiensis (strain Al Hakam) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|C3LFI0|ATPG_BACAC | ATP synthase gamma chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|C3P1F5|ATPG_BACAA | ATP synthase gamma chain OS=Bacillus anthracis (strain A0248) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|A1AXU3|ATPG_RUTMC | ATP synthase gamma chain OS=Ruthia magnifica subsp. Calyptogena magnifica GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|Q5HBD0|ATPG_EHRRW | ATP synthase gamma chain OS=Ehrlichia ruminantium (strain Welgevonden) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-29 |
sp|P9WPU9|ATPG_MYCTU | ATP synthase gamma chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=atpG PE=1 SV=1 | 28 | 304 | 1.0E-28 |
sp|P9WPU8|ATPG_MYCTO | ATP synthase gamma chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=atpG PE=3 SV=1 | 28 | 304 | 1.0E-28 |
sp|A5U208|ATPG_MYCTA | ATP synthase gamma chain OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=atpG PE=3 SV=1 | 28 | 304 | 1.0E-28 |
sp|C1AMV3|ATPG_MYCBT | ATP synthase gamma chain OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=atpG PE=3 SV=1 | 28 | 304 | 1.0E-28 |
sp|A1KI97|ATPG_MYCBP | ATP synthase gamma chain OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=atpG PE=3 SV=1 | 28 | 304 | 1.0E-28 |
sp|P63672|ATPG_MYCBO | ATP synthase gamma chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=atpG PE=3 SV=1 | 28 | 304 | 1.0E-28 |
sp|B7IQV9|ATPG_BACC2 | ATP synthase gamma chain OS=Bacillus cereus (strain G9842) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-28 |
sp|Q2YCA4|ATPG_NITMU | ATP synthase gamma chain OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-28 |
sp|A1K1S1|ATPG_AZOSB | ATP synthase gamma chain OS=Azoarcus sp. (strain BH72) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-28 |
sp|Q07VU3|ATPG_SHEFN | ATP synthase gamma chain OS=Shewanella frigidimarina (strain NCIMB 400) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-28 |
sp|C3K1E7|ATPG_PSEFS | ATP synthase gamma chain OS=Pseudomonas fluorescens (strain SBW25) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-28 |
sp|C1D5G3|ATPG_LARHH | ATP synthase gamma chain OS=Laribacter hongkongensis (strain HLHK9) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-28 |
sp|Q6AQ11|ATPG_DESPS | ATP synthase gamma chain OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-28 |
sp|Q4FQ36|ATPG_PSYA2 | ATP synthase gamma chain OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-28 |
sp|A9VSA4|ATPG_BACWK | ATP synthase gamma chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-28 |
sp|P05435|ATPG_SPIOL | ATP synthase gamma chain, chloroplastic OS=Spinacia oleracea GN=ATPC PE=1 SV=2 | 28 | 303 | 2.0E-28 |
sp|Q13SQ1|ATPG_BURXL | ATP synthase gamma chain OS=Burkholderia xenovorans (strain LB400) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-28 |
sp|C1A697|ATPG_GEMAT | ATP synthase gamma chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-28 |
sp|A1TJ40|ATPG_ACIAC | ATP synthase gamma chain OS=Acidovorax citrulli (strain AAC00-1) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-28 |
sp|B1XHY7|ATPG_SYNP2 | ATP synthase gamma chain OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-28 |
sp|P42007|ATPG_GEOSE | ATP synthase gamma chain OS=Geobacillus stearothermophilus GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-28 |
sp|Q01908|ATPG1_ARATH | ATP synthase gamma chain 1, chloroplastic OS=Arabidopsis thaliana GN=ATPC1 PE=1 SV=1 | 6 | 303 | 2.0E-28 |
sp|P37810|ATPG_BACSU | ATP synthase gamma chain OS=Bacillus subtilis (strain 168) GN=atpG PE=1 SV=2 | 27 | 304 | 2.0E-28 |
sp|Q05384|ATPG_SYNP1 | ATP synthase gamma chain OS=Synechococcus sp. (strain PCC 6716) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-28 |
sp|A7ZC36|ATPG_CAMC1 | ATP synthase gamma chain OS=Campylobacter concisus (strain 13826) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-28 |
sp|B2T7K1|ATPG_BURPP | ATP synthase gamma chain OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-28 |
sp|Q5FH34|ATPG_EHRRG | ATP synthase gamma chain OS=Ehrlichia ruminantium (strain Gardel) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-28 |
sp|B3R7L6|ATPG_CUPTR | ATP synthase gamma chain OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-28 |
sp|Q9PE84|ATPG_XYLFA | ATP synthase gamma chain OS=Xylella fastidiosa (strain 9a5c) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-28 |
sp|Q3B1F5|ATPG_CHLL7 | ATP synthase gamma chain OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-28 |
sp|A0M6G3|ATPG_GRAFK | ATP synthase gamma chain OS=Gramella forsetii (strain KT0803) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-28 |
sp|A3QJR1|ATPG_SHELP | ATP synthase gamma chain OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-28 |
sp|A7Z9Q1|ATPG_BACMF | ATP synthase gamma chain OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-28 |
sp|Q6LKZ7|ATPG2_PHOPR | ATP synthase gamma chain 2 OS=Photobacterium profundum GN=atpG2 PE=3 SV=1 | 27 | 304 | 3.0E-28 |
sp|B1WUI3|ATPG_CYAA5 | ATP synthase gamma chain OS=Cyanothece sp. (strain ATCC 51142) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-28 |
sp|B0U599|ATPG_XYLFM | ATP synthase gamma chain OS=Xylella fastidiosa (strain M12) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-28 |
sp|B2UGV0|ATPG_RALPJ | ATP synthase gamma chain OS=Ralstonia pickettii (strain 12J) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-28 |
sp|B4UKF1|ATPG_ANASK | ATP synthase gamma chain OS=Anaeromyxobacter sp. (strain K) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-28 |
sp|Q82XP9|ATPG_NITEU | ATP synthase gamma chain OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-28 |
sp|Q1Q898|ATPG_PSYCK | ATP synthase gamma chain OS=Psychrobacter cryohalolentis (strain K5) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-28 |
sp|Q3SF65|ATPG_THIDA | ATP synthase gamma chain OS=Thiobacillus denitrificans (strain ATCC 25259) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-28 |
sp|A8FIB3|ATPG_BACP2 | ATP synthase gamma chain OS=Bacillus pumilus (strain SAFR-032) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-28 |
sp|C5BKJ6|ATPG_TERTT | ATP synthase gamma chain OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-28 |
sp|P50005|ATPG_ACEWD | ATP synthase gamma chain, sodium ion specific OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655) GN=atpG PE=1 SV=3 | 30 | 304 | 5.0E-28 |
sp|A1SBU1|ATPG_SHEAM | ATP synthase gamma chain OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-28 |
sp|C5BF39|ATPG_EDWI9 | ATP synthase gamma chain OS=Edwardsiella ictaluri (strain 93-146) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-28 |
sp|A9GHR3|ATPG_SORC5 | ATP synthase gamma chain OS=Sorangium cellulosum (strain So ce56) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-28 |
sp|Q7VPP1|ATPG_HAEDU | ATP synthase gamma chain OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-28 |
sp|B8JCV1|ATPG_ANAD2 | ATP synthase gamma chain OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-28 |
sp|A9AVV3|ATPG_HERA2 | ATP synthase gamma chain OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-28 |
sp|A5E949|ATPG_BRASB | ATP synthase gamma chain OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-28 |
sp|Q39KX7|ATPG_BURL3 | ATP synthase gamma chain OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-28 |
sp|A1BJF4|ATPG_CHLPD | ATP synthase gamma chain OS=Chlorobium phaeobacteroides (strain DSM 266) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-28 |
sp|A0RR27|ATPG_CAMFF | ATP synthase gamma chain OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-28 |
sp|A7H018|ATPG_CAMC5 | ATP synthase gamma chain OS=Campylobacter curvus (strain 525.92) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-28 |
sp|A9BPU6|ATPG_DELAS | ATP synthase gamma chain OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-28 |
sp|Q98EV7|ATPG_RHILO | ATP synthase gamma chain OS=Rhizobium loti (strain MAFF303099) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-28 |
sp|A5FL19|ATPG_FLAJ1 | ATP synthase gamma chain OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-28 |
sp|B3EHU5|ATPG_CHLL2 | ATP synthase gamma chain OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|P41010|ATPG_BACCA | ATP synthase gamma chain OS=Bacillus caldotenax GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|Q7VU45|ATPG_BORPE | ATP synthase gamma chain OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|Q3YVN7|ATPG_SHISS | ATP synthase gamma chain OS=Shigella sonnei (strain Ss046) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|C6DJH1|ATPG_PECCP | ATP synthase gamma chain OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|A6W3S9|ATPG_MARMS | ATP synthase gamma chain OS=Marinomonas sp. (strain MWYL1) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|Q0BJL6|ATPG_BURCM | ATP synthase gamma chain OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|B1YQL3|ATPG_BURA4 | ATP synthase gamma chain OS=Burkholderia ambifaria (strain MC40-6) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|Q7WEM8|ATPG_BORBR | ATP synthase gamma chain OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|A4YKD9|ATPG_BRASO | ATP synthase gamma chain OS=Bradyrhizobium sp. (strain ORS278) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|Q0I5X2|ATPG_HAES1 | ATP synthase gamma chain OS=Haemophilus somnus (strain 129Pt) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|B2J059|ATPG_NOSP7 | ATP synthase gamma chain OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|A6VL58|ATPG_ACTSZ | ATP synthase gamma chain OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|Q12HQ0|ATPG_SHEDO | ATP synthase gamma chain OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|B8CZ11|ATPG_HALOH | ATP synthase gamma chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|B0UWG6|ATPG_HISS2 | ATP synthase gamma chain OS=Histophilus somni (strain 2336) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|B5BIN7|ATPG_SALPK | ATP synthase gamma chain OS=Salmonella paratyphi A (strain AKU_12601) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|Q5PKX1|ATPG_SALPA | ATP synthase gamma chain OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-27 |
sp|B9L7Y6|ATPG_NAUPA | ATP synthase gamma chain OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A7MMX0|ATPG_CROS8 | ATP synthase gamma chain OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q63PH9|ATPG_BURPS | ATP synthase gamma chain OS=Burkholderia pseudomallei (strain K96243) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A3NF41|ATPG_BURP6 | ATP synthase gamma chain OS=Burkholderia pseudomallei (strain 668) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q3JXV7|ATPG_BURP1 | ATP synthase gamma chain OS=Burkholderia pseudomallei (strain 1710b) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A1V8T2|ATPG_BURMS | ATP synthase gamma chain OS=Burkholderia mallei (strain SAVP1) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q62FR6|ATPG_BURMA | ATP synthase gamma chain OS=Burkholderia mallei (strain ATCC 23344) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A2S6J9|ATPG_BURM9 | ATP synthase gamma chain OS=Burkholderia mallei (strain NCTC 10229) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A3MQJ8|ATPG_BURM7 | ATP synthase gamma chain OS=Burkholderia mallei (strain NCTC 10247) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|B4EEY8|ATPG_BURCJ | ATP synthase gamma chain OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|C4K904|ATPG_HAMD5 | ATP synthase gamma chain OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q6MGM6|ATPG_BDEBA | ATP synthase gamma chain OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q7A0C5|ATPG_STAAW | ATP synthase gamma chain OS=Staphylococcus aureus (strain MW2) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A8YY71|ATPG_STAAT | ATP synthase gamma chain OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q6G7K6|ATPG_STAAS | ATP synthase gamma chain OS=Staphylococcus aureus (strain MSSA476) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q6GEX1|ATPG_STAAR | ATP synthase gamma chain OS=Staphylococcus aureus (strain MRSA252) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q7A4E8|ATPG_STAAN | ATP synthase gamma chain OS=Staphylococcus aureus (strain N315) GN=atpG PE=1 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q99SF4|ATPG_STAAM | ATP synthase gamma chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A6QIU8|ATPG_STAAE | ATP synthase gamma chain OS=Staphylococcus aureus (strain Newman) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q5HE96|ATPG_STAAC | ATP synthase gamma chain OS=Staphylococcus aureus (strain COL) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A5IUP9|ATPG_STAA9 | ATP synthase gamma chain OS=Staphylococcus aureus (strain JH9) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A6U3I9|ATPG_STAA2 | ATP synthase gamma chain OS=Staphylococcus aureus (strain JH1) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A7X4U4|ATPG_STAA1 | ATP synthase gamma chain OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A9MJR8|ATPG_SALAR | ATP synthase gamma chain OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|B8G6G7|ATPG_CHLAD | ATP synthase gamma chain OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A0ALL4|ATPG_LISW6 | ATP synthase gamma chain OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A4VS63|ATPG_PSEU5 | ATP synthase gamma chain OS=Pseudomonas stutzeri (strain A1501) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q7W3A9|ATPG_BORPA | ATP synthase gamma chain OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|B1KQ35|ATPG_SHEWM | ATP synthase gamma chain OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q8ZKW8|ATPG_SALTY | ATP synthase gamma chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=atpG PE=2 SV=1 | 27 | 304 | 2.0E-27 |
sp|B4TN32|ATPG_SALSV | ATP synthase gamma chain OS=Salmonella schwarzengrund (strain CVM19633) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|C0Q2N3|ATPG_SALPC | ATP synthase gamma chain OS=Salmonella paratyphi C (strain RKS4594) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A9MXA7|ATPG_SALPB | ATP synthase gamma chain OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|B4SYD2|ATPG_SALNS | ATP synthase gamma chain OS=Salmonella newport (strain SL254) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|B4TAX3|ATPG_SALHS | ATP synthase gamma chain OS=Salmonella heidelberg (strain SL476) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|B5QUS5|ATPG_SALEP | ATP synthase gamma chain OS=Salmonella enteritidis PT4 (strain P125109) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|B5FN34|ATPG_SALDC | ATP synthase gamma chain OS=Salmonella dublin (strain CT_02021853) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|Q57HX8|ATPG_SALCH | ATP synthase gamma chain OS=Salmonella choleraesuis (strain SC-B67) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|B5EYZ7|ATPG_SALA4 | ATP synthase gamma chain OS=Salmonella agona (strain SL483) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A8HAG4|ATPG_SHEPA | ATP synthase gamma chain OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A6T471|ATPG_JANMA | ATP synthase gamma chain OS=Janthinobacterium sp. (strain Marseille) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-27 |
sp|A9AJG3|ATPG_BURM1 | ATP synthase gamma chain OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-27 |
sp|B5RFW2|ATPG_SALG2 | ATP synthase gamma chain OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-27 |
sp|Q87E89|ATPG_XYLFT | ATP synthase gamma chain OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-27 |
sp|B2I861|ATPG_XYLF2 | ATP synthase gamma chain OS=Xylella fastidiosa (strain M23) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-27 |
sp|Q5QZI5|ATPG_IDILO | ATP synthase gamma chain OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-27 |
sp|Q8XU75|ATPG_RALSO | ATP synthase gamma chain OS=Ralstonia solanacearum (strain GMI1000) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-27 |
sp|A3P0Z1|ATPG_BURP0 | ATP synthase gamma chain OS=Burkholderia pseudomallei (strain 1106a) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-27 |
sp|Q3Z8Z3|ATPG_DEHM1 | ATP synthase gamma chain OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=atpG PE=3 SV=1 | 39 | 304 | 4.0E-27 |
sp|P0ABA9|ATPG_SHIFL | ATP synthase gamma chain OS=Shigella flexneri GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|Q0SYU3|ATPG_SHIF8 | ATP synthase gamma chain OS=Shigella flexneri serotype 5b (strain 8401) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|Q329S2|ATPG_SHIDS | ATP synthase gamma chain OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B2TUP2|ATPG_SHIB3 | ATP synthase gamma chain OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B7LK78|ATPG_ESCF3 | ATP synthase gamma chain OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|Q1R4K1|ATPG_ECOUT | ATP synthase gamma chain OS=Escherichia coli (strain UTI89 / UPEC) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B1LL60|ATPG_ECOSM | ATP synthase gamma chain OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B6I3X0|ATPG_ECOSE | ATP synthase gamma chain OS=Escherichia coli (strain SE11) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B7NF49|ATPG_ECOLU | ATP synthase gamma chain OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|P0ABA6|ATPG_ECOLI | ATP synthase gamma chain OS=Escherichia coli (strain K12) GN=atpG PE=1 SV=1 | 27 | 304 | 4.0E-27 |
sp|B1IX05|ATPG_ECOLC | ATP synthase gamma chain OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|P0ABA7|ATPG_ECOL6 | ATP synthase gamma chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|Q0TAX6|ATPG_ECOL5 | ATP synthase gamma chain OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|A1AHR5|ATPG_ECOK1 | ATP synthase gamma chain OS=Escherichia coli O1:K1 / APEC GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|A8A6J6|ATPG_ECOHS | ATP synthase gamma chain OS=Escherichia coli O9:H4 (strain HS) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B1X9W1|ATPG_ECODH | ATP synthase gamma chain OS=Escherichia coli (strain K12 / DH10B) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|C4ZZ11|ATPG_ECOBW | ATP synthase gamma chain OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B7M589|ATPG_ECO8A | ATP synthase gamma chain OS=Escherichia coli O8 (strain IAI1) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B7N2H2|ATPG_ECO81 | ATP synthase gamma chain OS=Escherichia coli O81 (strain ED1a) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B7NR35|ATPG_ECO7I | ATP synthase gamma chain OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B5YXD7|ATPG_ECO5E | ATP synthase gamma chain OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|P0ABA8|ATPG_ECO57 | ATP synthase gamma chain OS=Escherichia coli O157:H7 GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B7MGF3|ATPG_ECO45 | ATP synthase gamma chain OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B7UMJ8|ATPG_ECO27 | ATP synthase gamma chain OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|A9KX07|ATPG_SHEB9 | ATP synthase gamma chain OS=Shewanella baltica (strain OS195) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|A6WUJ1|ATPG_SHEB8 | ATP synthase gamma chain OS=Shewanella baltica (strain OS185) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|A3DAR5|ATPG_SHEB5 | ATP synthase gamma chain OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B8EDV1|ATPG_SHEB2 | ATP synthase gamma chain OS=Shewanella baltica (strain OS223) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|Q9K6H4|ATPG_BACHD | ATP synthase gamma chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|Q8DLU1|ATPG_THEEB | ATP synthase gamma chain OS=Thermosynechococcus elongatus (strain BP-1) GN=atpG PE=1 SV=1 | 27 | 304 | 4.0E-27 |
sp|B8HPK2|ATPG_CYAP4 | ATP synthase gamma chain OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|Q9RQ74|ATPG_BUCMH | ATP synthase gamma chain OS=Buchnera aphidicola subsp. Melaphis rhois GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B3QL62|ATPG_CHLP8 | ATP synthase gamma chain OS=Chlorobaculum parvum (strain NCIB 8327) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-27 |
sp|B4RS82|ATPG_ALTMD | ATP synthase gamma chain OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-27 |
sp|Q1MP34|ATPG_LAWIP | ATP synthase gamma chain OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-27 |
sp|A5WBW0|ATPG_PSYWF | ATP synthase gamma chain OS=Psychrobacter sp. (strain PRwf-1) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-27 |
sp|B0TQF5|ATPG_SHEHH | ATP synthase gamma chain OS=Shewanella halifaxensis (strain HAW-EB4) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-27 |
sp|A6TG37|ATPG_KLEP7 | ATP synthase gamma chain OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-27 |
sp|B3EU99|ATPG_AMOA5 | ATP synthase gamma chain OS=Amoebophilus asiaticus (strain 5a2) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-27 |
sp|B5XZM3|ATPG_KLEP3 | ATP synthase gamma chain OS=Klebsiella pneumoniae (strain 342) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-27 |
sp|Q73X58|ATPG_MYCPA | ATP synthase gamma chain OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=atpG PE=3 SV=1 | 28 | 304 | 6.0E-27 |
sp|A0QCX7|ATPG_MYCA1 | ATP synthase gamma chain OS=Mycobacterium avium (strain 104) GN=atpG PE=3 SV=1 | 28 | 304 | 6.0E-27 |
sp|A9HY41|ATPG_BORPD | ATP synthase gamma chain OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-27 |
sp|Q2YUK0|ATPG_STAAB | ATP synthase gamma chain OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-27 |
sp|Q2STE8|ATPG_BURTA | ATP synthase gamma chain OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-27 |
sp|B7KKR3|ATPG_CYAP7 | ATP synthase gamma chain OS=Cyanothece sp. (strain PCC 7424) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-27 |
sp|A4WGF4|ATPG_ENT38 | ATP synthase gamma chain OS=Enterobacter sp. (strain 638) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-27 |
sp|Q927W3|ATPG_LISMO | ATP synthase gamma chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-27 |
sp|B8DBI0|ATPG_LISMH | ATP synthase gamma chain OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-27 |
sp|Q71WP8|ATPG_LISMF | ATP synthase gamma chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-27 |
sp|C1KYU7|ATPG_LISMC | ATP synthase gamma chain OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-27 |
sp|Q7ANV0|ATPG_LISIN | ATP synthase gamma chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-27 |
sp|Q8Z2Q5|ATPG_SALTI | ATP synthase gamma chain OS=Salmonella typhi GN=atpG PE=3 SV=1 | 27 | 304 | 7.0E-27 |
sp|Q67TB8|ATPG_SYMTH | ATP synthase gamma chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=atpG PE=3 SV=1 | 33 | 304 | 7.0E-27 |
sp|Q93Q45|ATPG_CLOPA | ATP synthase gamma chain OS=Clostridium pasteurianum GN=atpG PE=3 SV=1 | 28 | 303 | 8.0E-27 |
sp|A0PUK1|ATPG_MYCUA | ATP synthase gamma chain OS=Mycobacterium ulcerans (strain Agy99) GN=atpG PE=3 SV=1 | 28 | 304 | 9.0E-27 |
sp|Q8RGE1|ATPG_FUSNN | ATP synthase gamma chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-26 |
sp|Q31UN3|ATPG_SHIBS | ATP synthase gamma chain OS=Shigella boydii serotype 4 (strain Sb227) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-26 |
sp|Q8KAW9|ATPG_CHLTE | ATP synthase gamma chain OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-26 |
sp|B3QWX8|ATPG_CHLT3 | ATP synthase gamma chain OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-26 |
sp|B8CVU6|ATPG_SHEPW | ATP synthase gamma chain OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-26 |
sp|P29790|ATPG_TOBAC | ATP synthase gamma chain, chloroplastic OS=Nicotiana tabacum GN=ATPC PE=1 SV=1 | 30 | 304 | 1.0E-26 |
sp|B3H2P4|ATPG_ACTP7 | ATP synthase gamma chain OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-26 |
sp|A3N2U5|ATPG_ACTP2 | ATP synthase gamma chain OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-26 |
sp|B7L880|ATPG_ECO55 | ATP synthase gamma chain OS=Escherichia coli (strain 55989 / EAEC) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-26 |
sp|A7ZTU5|ATPG_ECO24 | ATP synthase gamma chain OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-26 |
sp|A8L3W4|ATPG_FRASN | ATP synthase gamma chain OS=Frankia sp. (strain EAN1pec) GN=atpG PE=3 SV=1 | 30 | 304 | 1.0E-26 |
sp|B1Y3S8|ATPG_LEPCP | ATP synthase gamma chain OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-26 |
sp|Q3IK49|ATPG_PSEHT | ATP synthase gamma chain OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-26 |
sp|Q7VQV7|ATPG_BLOFL | ATP synthase gamma chain OS=Blochmannia floridanus GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-26 |
sp|Q8E8B9|ATPG_SHEON | ATP synthase gamma chain OS=Shewanella oneidensis (strain MR-1) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-26 |
sp|A0L2S9|ATPG_SHESA | ATP synthase gamma chain OS=Shewanella sp. (strain ANA-3) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-26 |
sp|A1W2T6|ATPG_ACISJ | ATP synthase gamma chain OS=Acidovorax sp. (strain JS42) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-26 |
sp|B9MBA2|ATPG_ACIET | ATP synthase gamma chain OS=Acidovorax ebreus (strain TPSY) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-26 |
sp|Q3M9W1|ATPG_ANAVT | ATP synthase gamma chain OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-26 |
sp|Q65DX3|ATPG_BACLD | ATP synthase gamma chain OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-26 |
sp|Q8EM82|ATPG_OCEIH | ATP synthase gamma chain OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-26 |
sp|B2HQK3|ATPG_MYCMM | ATP synthase gamma chain OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=atpG PE=3 SV=1 | 28 | 304 | 3.0E-26 |
sp|B0BRX3|ATPG_ACTPJ | ATP synthase gamma chain OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=atpG PE=3 SV=1 | 27 | 304 | 3.0E-26 |
sp|Q1CSD4|ATPG_HELPH | ATP synthase gamma chain OS=Helicobacter pylori (strain HPAG1) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-26 |
sp|A7I176|ATPG_CAMHC | ATP synthase gamma chain OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-26 |
sp|Q0HPG0|ATPG_SHESR | ATP synthase gamma chain OS=Shewanella sp. (strain MR-7) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-26 |
sp|Q0HD78|ATPG_SHESM | ATP synthase gamma chain OS=Shewanella sp. (strain MR-4) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-26 |
sp|P12113|ATPG_CHLRE | ATP synthase gamma chain, chloroplastic OS=Chlamydomonas reinhardtii GN=ATPC PE=1 SV=1 | 17 | 303 | 4.0E-26 |
sp|Q89B40|ATPG_BUCBP | ATP synthase gamma chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-26 |
sp|Q477Z2|ATPG_DECAR | ATP synthase gamma chain OS=Dechloromonas aromatica (strain RCB) GN=atpG PE=3 SV=1 | 27 | 304 | 4.0E-26 |
sp|Q4L7Y5|ATPG_STAHJ | ATP synthase gamma chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-26 |
sp|A4GAH0|ATPG_HERAR | ATP synthase gamma chain OS=Herminiimonas arsenicoxydans GN=atpG PE=3 SV=1 | 27 | 304 | 5.0E-26 |
sp|P08450|ATPG_SYNP6 | ATP synthase gamma chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=atpG PE=3 SV=2 | 27 | 304 | 6.0E-26 |
sp|A1U7H5|ATPG_MARHV | ATP synthase gamma chain OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-26 |
sp|A4FN28|ATPG_SACEN | ATP synthase gamma chain OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-26 |
sp|Q5GRT1|ATPG_WOLTR | ATP synthase gamma chain OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=atpG PE=3 SV=1 | 27 | 304 | 6.0E-26 |
sp|Q8EWY9|ATPG_MYCPE | ATP synthase gamma chain OS=Mycoplasma penetrans (strain HF-2) GN=atpG PE=3 SV=1 | 27 | 301 | 6.0E-26 |
sp|A1WF57|ATPG_VEREI | ATP synthase gamma chain OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpG PE=3 SV=1 | 27 | 299 | 7.0E-26 |
sp|Q31RF0|ATPG_SYNE7 | ATP synthase gamma chain OS=Synechococcus elongatus (strain PCC 7942) GN=atpG PE=3 SV=1 | 27 | 304 | 8.0E-26 |
sp|Q7MA19|ATPG_WOLSU | ATP synthase gamma chain OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=atpG PE=3 SV=1 | 28 | 304 | 8.0E-26 |
sp|Q65Q06|ATPG_MANSM | ATP synthase gamma chain OS=Mannheimia succiniciproducens (strain MBEL55E) GN=atpG PE=3 SV=1 | 27 | 304 | 9.0E-26 |
sp|B9LBM1|ATPG_CHLSY | ATP synthase gamma chain OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-25 |
sp|A9WGS5|ATPG_CHLAA | ATP synthase gamma chain OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-25 |
sp|Q6MS93|ATPG_MYCMS | ATP synthase gamma chain OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=atpG PE=3 SV=1 | 27 | 303 | 1.0E-25 |
sp|P12408|ATPG_NOSS1 | ATP synthase gamma chain OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=atpG PE=3 SV=2 | 27 | 304 | 1.0E-25 |
sp|A8ACN7|ATPG_CITK8 | ATP synthase gamma chain OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-25 |
sp|Q8CNJ6|ATPG_STAES | ATP synthase gamma chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-25 |
sp|Q5HMB8|ATPG_STAEQ | ATP synthase gamma chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-25 |
sp|B2UUP1|ATPG_HELPS | ATP synthase gamma chain OS=Helicobacter pylori (strain Shi470) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-25 |
sp|C1DND4|ATPG_AZOVD | ATP synthase gamma chain OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-25 |
sp|P45824|ATPG_MYCLE | ATP synthase gamma chain OS=Mycobacterium leprae (strain TN) GN=atpG PE=3 SV=1 | 28 | 304 | 1.0E-25 |
sp|B8ZR41|ATPG_MYCLB | ATP synthase gamma chain OS=Mycobacterium leprae (strain Br4923) GN=atpG PE=3 SV=1 | 28 | 304 | 1.0E-25 |
sp|B0JWV2|ATPG_MICAN | ATP synthase gamma chain OS=Microcystis aeruginosa (strain NIES-843) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-25 |
sp|A8ZUA0|ATPG_DESOH | ATP synthase gamma chain OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=atpG PE=3 SV=1 | 27 | 304 | 1.0E-25 |
sp|P17253|ATPG_SYNY3 | ATP synthase gamma chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=atpG PE=3 SV=1 | 27 | 304 | 2.0E-25 |
GO Term | Description | Terminal node |
---|---|---|
GO:0045261 | proton-transporting ATP synthase complex, catalytic core F(1) | Yes |
GO:0015986 | proton motive force-driven ATP synthesis | Yes |
GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism | Yes |
GO:0044238 | primary metabolic process | No |
GO:0032991 | protein-containing complex | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0006754 | ATP biosynthetic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0009117 | nucleotide metabolic process | No |
GO:0015318 | inorganic molecular entity transmembrane transporter activity | No |
GO:0009165 | nucleotide biosynthetic process | No |
GO:1901137 | carbohydrate derivative biosynthetic process | No |
GO:0006796 | phosphate-containing compound metabolic process | No |
GO:0009142 | nucleoside triphosphate biosynthetic process | No |
GO:0019637 | organophosphate metabolic process | No |
GO:1901135 | carbohydrate derivative metabolic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0016874 | ligase activity | No |
GO:1901360 | organic cyclic compound metabolic process | No |
GO:0033178 | proton-transporting two-sector ATPase complex, catalytic domain | No |
GO:0006163 | purine nucleotide metabolic process | No |
GO:0009141 | nucleoside triphosphate metabolic process | No |
GO:0022857 | transmembrane transporter activity | No |
GO:0005575 | cellular_component | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0003674 | molecular_function | No |
GO:0005216 | ion channel activity | No |
GO:0015078 | proton transmembrane transporter activity | No |
GO:0008152 | metabolic process | No |
GO:0055086 | nucleobase-containing small molecule metabolic process | No |
GO:0072522 | purine-containing compound biosynthetic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0046034 | ATP metabolic process | No |
GO:0022890 | inorganic cation transmembrane transporter activity | No |
GO:0046390 | ribose phosphate biosynthetic process | No |
GO:0046483 | heterocycle metabolic process | No |
GO:0006753 | nucleoside phosphate metabolic process | No |
GO:0006164 | purine nucleotide biosynthetic process | No |
GO:0005261 | cation channel activity | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0009150 | purine ribonucleotide metabolic process | No |
GO:1901293 | nucleoside phosphate biosynthetic process | No |
GO:0015252 | proton channel activity | No |
GO:0009206 | purine ribonucleoside triphosphate biosynthetic process | No |
GO:0006139 | nucleobase-containing compound metabolic process | No |
GO:0005215 | transporter activity | No |
GO:0090407 | organophosphate biosynthetic process | No |
GO:0072521 | purine-containing compound metabolic process | No |
GO:0018130 | heterocycle biosynthetic process | No |
GO:0015075 | ion transmembrane transporter activity | No |
GO:0008150 | biological_process | No |
GO:0009145 | purine nucleoside triphosphate biosynthetic process | No |
GO:0015267 | channel activity | No |
GO:0044281 | small molecule metabolic process | No |
GO:0009201 | ribonucleoside triphosphate biosynthetic process | No |
GO:0006793 | phosphorus metabolic process | No |
GO:0009259 | ribonucleotide metabolic process | No |
GO:0022803 | passive transmembrane transporter activity | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0008324 | cation transmembrane transporter activity | No |
GO:0009205 | purine ribonucleoside triphosphate metabolic process | No |
GO:0034654 | nucleobase-containing compound biosynthetic process | No |
GO:0098796 | membrane protein complex | No |
GO:0009058 | biosynthetic process | No |
GO:0009987 | cellular process | No |
GO:0009144 | purine nucleoside triphosphate metabolic process | No |
GO:0006725 | cellular aromatic compound metabolic process | No |
GO:0009199 | ribonucleoside triphosphate metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:1901362 | organic cyclic compound biosynthetic process | No |
GO:0009260 | ribonucleotide biosynthetic process | No |
GO:0003824 | catalytic activity | No |
GO:0019438 | aromatic compound biosynthetic process | No |
GO:0019693 | ribose phosphate metabolic process | No |
GO:0009152 | purine ribonucleotide biosynthetic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 25 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Agabi119p4|114950 MSLLARSVLRTAAVQPAVAAPAQARNMATLREIELRLKSVRNIEKITKSMKMIASTKLAKAQRAMNAGKQYGIAN AEVFANTPSDKPTPTKLFIVVSSDKGLCGGIHSSVTKATRKALSGHPESPLPQGTEVSPDSSISIIGDKSKSQLV RQQASRYHITFNQIGRDIPTFADAAGVADLIIKSGVQFDSVVLVYNKFVSAISYEAAIMEVKGEEALKESASFSA YENEDDATKDLVEFSLANAIYAALVEGHACEQSARRNAMDNASKNASDMISTLTMQYNRGRQASITNELVDIITG ASAL* |
Coding | >Agabi119p4|114950 ATGTCCTTGCTCGCCCGCTCAGTCCTCCGCACGGCCGCAGTGCAGCCCGCCGTGGCCGCCCCAGCGCAGGCCCGC AACATGGCCACCCTCCGTGAGATCGAGCTGCGCTTGAAGTCAGTCAGAAACATCGAAAAAATCACAAAGTCGATG AAAATGATTGCTTCCACCAAACTTGCAAAGGCTCAGAGGGCAATGAATGCCGGAAAGCAGTATGGTATCGCCAAC GCGGAGGTCTTTGCCAACACTCCTTCTGATAAACCAACACCAACAAAGCTCTTCATCGTTGTATCGTCCGACAAG GGTCTTTGCGGTGGTATTCACTCCTCCGTCACGAAGGCTACTCGCAAAGCCCTCTCCGGCCACCCCGAATCGCCT CTGCCCCAAGGCACAGAAGTCAGCCCAGACTCGTCCATTTCCATCATTGGTGACAAGTCCAAGAGTCAGCTTGTC CGACAACAAGCTTCTCGCTATCACATCACTTTCAACCAAATCGGCAGGGATATTCCCACTTTTGCTGACGCTGCT GGTGTCGCGGACCTTATTATCAAGAGTGGTGTCCAATTCGATTCTGTTGTCCTTGTTTACAACAAGTTCGTTTCT GCCATTTCGTATGAGGCTGCTATCATGGAGGTGAAGGGTGAAGAGGCTTTGAAGGAGAGTGCCTCTTTCAGTGCA TACGAGAATGAGGACGATGCTACCAAAGACCTTGTGGAATTCTCTTTAGCCAACGCCATCTATGCTGCTCTTGTG GAGGGTCACGCTTGTGAACAAAGTGCTCGTCGTAATGCCATGGACAACGCTTCCAAGAACGCCTCTGACATGATT TCAACCCTTACCATGCAGTACAATCGTGGTCGTCAAGCTTCCATCACGAACGAACTGGTGGATATCATTACCGGT GCCAGTGCTCTTTAG |
Transcript | >Agabi119p4|114950 ATGTCCTTGCTCGCCCGCTCAGTCCTCCGCACGGCCGCAGTGCAGCCCGCCGTGGCCGCCCCAGCGCAGGCCCGC AACATGGCCACCCTCCGTGAGATCGAGCTGCGCTTGAAGTCAGTCAGAAACATCGAAAAAATCACAAAGTCGATG AAAATGATTGCTTCCACCAAACTTGCAAAGGCTCAGAGGGCAATGAATGCCGGAAAGCAGTATGGTATCGCCAAC GCGGAGGTCTTTGCCAACACTCCTTCTGATAAACCAACACCAACAAAGCTCTTCATCGTTGTATCGTCCGACAAG GGTCTTTGCGGTGGTATTCACTCCTCCGTCACGAAGGCTACTCGCAAAGCCCTCTCCGGCCACCCCGAATCGCCT CTGCCCCAAGGCACAGAAGTCAGCCCAGACTCGTCCATTTCCATCATTGGTGACAAGTCCAAGAGTCAGCTTGTC CGACAACAAGCTTCTCGCTATCACATCACTTTCAACCAAATCGGCAGGGATATTCCCACTTTTGCTGACGCTGCT GGTGTCGCGGACCTTATTATCAAGAGTGGTGTCCAATTCGATTCTGTTGTCCTTGTTTACAACAAGTTCGTTTCT GCCATTTCGTATGAGGCTGCTATCATGGAGGTGAAGGGTGAAGAGGCTTTGAAGGAGAGTGCCTCTTTCAGTGCA TACGAGAATGAGGACGATGCTACCAAAGACCTTGTGGAATTCTCTTTAGCCAACGCCATCTATGCTGCTCTTGTG GAGGGTCACGCTTGTGAACAAAGTGCTCGTCGTAATGCCATGGACAACGCTTCCAAGAACGCCTCTGACATGATT TCAACCCTTACCATGCAGTACAATCGTGGTCGTCAAGCTTCCATCACGAACGAACTGGTGGATATCATTACCGGT GCCAGTGCTCTTTAG |
Gene | >Agabi119p4|114950 ATGTCCTTGCTCGCCCGCTCAGTCCTCCGCACGGCCGCAGTGCAGCCCGCCGTGGCCGCCCCAGCGCAGGCCCGC AACATGGCCACCCTCCGTGAGATCGAGCTGCGCTTGAAGTCAGTCAGAAACATCGAAAAAATCACAAAGGTCTGC TCAGGAAATACTGTCTGCAATACTCAAGCTGAACGCGTCTTGTAGTCGATGAAAATGATTGCTTCCACCAAACTT GCAAAGGCTCAGAGGGCAATGAATGCCGGAAAGCAGTATGGTATCGCCAACGCGGGTATGTTTTCTACCGTGTTT TTGACTTGGTTCACGACCTTCTCCAACTCTGTCTATCCTTTCTACAGAGGTCTTTGCCAACACTCCTTCTGATAA ACCAACACCAACAAAGCTCTTCATCGTTGTATCGTCCGACAAGGGTCTTTGCGGTGGTATTCACTCCTCCGTCAC GAAGGCTACTCGCAAAGCCCTCTCCGGCCACCCCGAATCGCCTCTGCCCCAAGGCACAGAAGTCAGCCCAGACTC GTCCATTTCCATCATTGGTGACAAGTCCAAGAGTCAGCTTGTCCGACAACAAGCTTCTCGCTATCACATCACTTT CAACCAAATCGGCAGGGATATTCCCACTTTTGCTGACGCTGCTGGTGTCGCGGACCTTATTATCAAGAGTGGTGT CCAATTCGATTCTGTTGTCCTTGTTTACAACAAGTTCGTTTCTGCCATTTCGTATGAGGCTGCTATCATGGAGGT GAAGGGTGAAGAGGCTTTGAAGGAGAGTGGTATGTGTTGATTCTCTTCTCCGCACGGGGCGGCTGCTCATTTCCG TGTTAGCCTCTTTCAGTGCATACGAGAATGAGGACGATGCTACCAAAGACCTTGTGGAATTCTCTTTAGCCAACG CCATCTATGCTGCTCTTGTGGAGGGTCACGCTTGTGAACAAAGTGCTCGGTGGGTCAACCCTACATCCCCTTTTG CTACTCAAATTCATATCTCAACTTTATAGTCGTAATGCCATGGACAACGCTTCCAAGAACGCCTCTGACATGATT TCAACCCTTACCATGCAGTACAATCGTGGTCGTCAAGCTTCCATCACGAACGAACTGGTGGATATCATTACCGGT ATGTCGCACCTGAAGCTTGATATCTGCACGGGATCTCACTTCTGTTTTAGGTGCCAGTGCTCTTTAG |