Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|114940
Gene name
Locationscaffold_09:472046..473728
Strand+
Gene length (bp)1682
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11735 CAP59_mtransfer Cryptococcal mannosyltransferase 1 6.6E-69 139 375

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6U1Z4|CMT1_CRYNJ Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CMT1 PE=1 SV=1 125 403 5.0E-42

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|114940
MKPATTIRRLPTAAALALGVFLGFLVARIIPWPSPSSPSWRSGHVPSRLQRARQQIPLPTTHQRERVLELLTTLS
SHYTKECTRNSQPLYVQQVLDRYAPLIGFTPPSDRSWIGALLGVSPDDDHLHVRRSDLSNKQHKYFFAINLYNSF
DVVPDLFATLFRVASILGYQNVFVSIYENGSNDQTKALLRIFNALTRSVGMRVMIRTSQRTRGQFNHRIEYLAEV
RNSAFVPLHELRETENEIFDTIIFMNDILPCVDDLLELIWQSRKNNAGITCAADYMYHSEIAAPVFYDNWVARDI
NGTALENAPFENIFHHPESSQRFQRHLPVQVQSCWNGIAVLDPAPFYSYPHVRFRMAKITEGECSASECSLICND
YWEAGYGRILMVPRVKLAYDSRVFDIIHPARRNLTAIRGYVRMGGLPEDPRTDPQDRSWFGPHDRLFTSEESEEL
EFINGPEYVWCWGWDGAGDLDGPDVDPIWERVSNRSLKREAVLVQHDRSLLL*
Coding >Agabi119p4|114940
ATGAAACCTGCCACGACCATCCGCAGACTGCCCACCGCCGCTGCCCTCGCCCTCGGCGTCTTTCTTGGTTTTCTC
GTTGCAAGAATCATTCCCTGGCCTTCTCCATCCTCGCCCAGTTGGCGCAGCGGACATGTTCCTTCACGCCTCCAA
CGCGCTCGCCAGCAGATTCCTCTTCCCACAACCCACCAGCGCGAGCGAGTGCTTGAACTCCTCACCACGCTCTCG
TCCCACTACACAAAAGAATGCACACGCAACTCTCAGCCACTCTATGTCCAGCAGGTCCTCGACCGCTATGCTCCC
CTCATAGGCTTCACCCCACCCTCCGATCGTTCCTGGATTGGCGCCCTTCTCGGTGTCTCCCCCGACGATGATCAC
CTCCATGTCCGCCGCTCAGACCTTTCCAACAAGCAGCACAAGTATTTTTTCGCCATCAACCTCTACAATTCTTTC
GACGTCGTCCCTGACCTCTTTGCAACCCTATTCCGCGTGGCTTCTATTCTCGGCTACCAAAACGTCTTTGTGTCC
ATATACGAAAACGGCTCTAATGACCAAACGAAAGCACTCCTTCGGATATTCAACGCTCTCACACGAAGTGTCGGT
ATGCGCGTCATGATTCGCACTTCTCAACGTACCCGAGGTCAATTCAACCACCGTATCGAATATCTCGCAGAAGTT
CGTAATTCCGCTTTCGTCCCTCTTCATGAACTTCGTGAAACCGAAAACGAAATCTTCGATACCATTATATTCATG
AACGATATCTTACCTTGCGTCGATGACCTTCTCGAATTGATCTGGCAATCCCGAAAAAATAATGCTGGGATCACT
TGTGCTGCAGATTATATGTATCATTCGGAAATTGCTGCTCCGGTGTTTTATGACAACTGGGTGGCTCGTGATATC
AATGGTACAGCACTCGAAAATGCGCCTTTTGAAAATATATTTCATCATCCAGAATCGTCTCAACGGTTCCAACGA
CATCTTCCTGTTCAAGTCCAAAGTTGTTGGAACGGTATCGCCGTTCTAGATCCTGCACCCTTTTATTCGTATCCT
CATGTTCGTTTTCGGATGGCCAAGATTACGGAAGGAGAGTGTAGTGCGAGTGAATGTAGTTTGATATGTAATGAT
TATTGGGAAGCTGGGTATGGTAGGATTTTAATGGTGCCTAGAGTGAAACTTGCATATGACAGCAGGGTATTTGAT
ATCATTCATCCAGCTAGAAGAAACCTTACCGCTATTCGTGGGTATGTACGTATGGGTGGATTACCTGAAGATCCA
CGTACAGATCCACAAGATCGATCATGGTTCGGTCCTCATGATCGTTTGTTCACTTCAGAAGAAAGTGAAGAACTT
GAATTTATTAATGGACCCGAATACGTTTGGTGTTGGGGTTGGGATGGAGCTGGAGATTTGGATGGACCGGATGTA
GATCCGATTTGGGAGAGAGTGTCGAATAGGTCGTTGAAACGGGAGGCTGTTTTGGTTCAACATGATCGTAGTCTT
TTATTATAG
Transcript >Agabi119p4|114940
ATGAAACCTGCCACGACCATCCGCAGACTGCCCACCGCCGCTGCCCTCGCCCTCGGCGTCTTTCTTGGTTTTCTC
GTTGCAAGAATCATTCCCTGGCCTTCTCCATCCTCGCCCAGTTGGCGCAGCGGACATGTTCCTTCACGCCTCCAA
CGCGCTCGCCAGCAGATTCCTCTTCCCACAACCCACCAGCGCGAGCGAGTGCTTGAACTCCTCACCACGCTCTCG
TCCCACTACACAAAAGAATGCACACGCAACTCTCAGCCACTCTATGTCCAGCAGGTCCTCGACCGCTATGCTCCC
CTCATAGGCTTCACCCCACCCTCCGATCGTTCCTGGATTGGCGCCCTTCTCGGTGTCTCCCCCGACGATGATCAC
CTCCATGTCCGCCGCTCAGACCTTTCCAACAAGCAGCACAAGTATTTTTTCGCCATCAACCTCTACAATTCTTTC
GACGTCGTCCCTGACCTCTTTGCAACCCTATTCCGCGTGGCTTCTATTCTCGGCTACCAAAACGTCTTTGTGTCC
ATATACGAAAACGGCTCTAATGACCAAACGAAAGCACTCCTTCGGATATTCAACGCTCTCACACGAAGTGTCGGT
ATGCGCGTCATGATTCGCACTTCTCAACGTACCCGAGGTCAATTCAACCACCGTATCGAATATCTCGCAGAAGTT
CGTAATTCCGCTTTCGTCCCTCTTCATGAACTTCGTGAAACCGAAAACGAAATCTTCGATACCATTATATTCATG
AACGATATCTTACCTTGCGTCGATGACCTTCTCGAATTGATCTGGCAATCCCGAAAAAATAATGCTGGGATCACT
TGTGCTGCAGATTATATGTATCATTCGGAAATTGCTGCTCCGGTGTTTTATGACAACTGGGTGGCTCGTGATATC
AATGGTACAGCACTCGAAAATGCGCCTTTTGAAAATATATTTCATCATCCAGAATCGTCTCAACGGTTCCAACGA
CATCTTCCTGTTCAAGTCCAAAGTTGTTGGAACGGTATCGCCGTTCTAGATCCTGCACCCTTTTATTCGTATCCT
CATGTTCGTTTTCGGATGGCCAAGATTACGGAAGGAGAGTGTAGTGCGAGTGAATGTAGTTTGATATGTAATGAT
TATTGGGAAGCTGGGTATGGTAGGATTTTAATGGTGCCTAGAGTGAAACTTGCATATGACAGCAGGGTATTTGAT
ATCATTCATCCAGCTAGAAGAAACCTTACCGCTATTCGTGGGTATGTACGTATGGGTGGATTACCTGAAGATCCA
CGTACAGATCCACAAGATCGATCATGGTTCGGTCCTCATGATCGTTTGTTCACTTCAGAAGAAAGTGAAGAACTT
GAATTTATTAATGGACCCGAATACGTTTGGTGTTGGGGTTGGGATGGAGCTGGAGATTTGGATGGACCGGATGTA
GATCCGATTTGGGAGAGAGTGTCGAATAGGTCGTTGAAACGGGAGGCTGTTTTGGTTCAACATGATCGTAGTCTT
TTATTATAG
Gene >Agabi119p4|114940
ATGAAACCTGCCACGACCATCCGCAGACTGCCCACCGCCGCTGCCCTCGCCCTCGGCGTCTTTCTTGGTTTTCTC
GTTGCAAGAATCATTCCCTGGCCTTCTGTACGTCTTTTTCTTTTGCGTACGATAACTTTCTCACATCCATTTGTA
GCCATCCTCGCCCAGTTGGCGCAGCGGACATGTTCCTTCACGCCTCCAACGCGCTCGCCAGCAGATTCCTCTTCC
CACAACCCACCAGCGCGAGCGAGTGCTTGAACTCCTCACCACGCTCTCGTCCCACTACACAAAAGAATGCACACG
CAACTCTCAGCCACTCTATGTCCAGCAGGTCCTCGACCGCTATGCTCCCCTCATAGGCTTCACCCCACCCTCCGA
TCGTTCCTGGATTGGCGCCCTTCTCGGTGTCTCCCCCGACGATGATCACCTCCATGTCCGCCGCTCAGACCTTTC
CAACAAGCAGCACAAGTATTTTTTCGCCATCAACCTCTACAATTCTTTCGACGTCGTCCCTGACCTCTTTGCAAC
CCTATTCCGCGTGGCTTCTATTCTCGGCTACCAAAACGTCTTTGTGTCCATATACGAAAACGGCTCTAATGACCA
AACGAAAGCACTCCTTCGGATATTCAACGCTCTCACACGAAGTGTCGGTATGCGCGTCATGATTCGCACTTCTCA
ACGTACCCGAGGTCAATTCAACCACCGTATCGAATATCTCGCAGAAGTTCGTAATTCCGCTTTCGTCCCTCTTCA
TGAACTTCGTGAAACCGAAAACGAAATCTTCGATACCATTATATTCATGAACGATATCTTACCTTGCGTCGATGA
CCTTCTCGAATTGATCTGGCAATCCCGAAAAAATAATGCTGGGATCACTTGTGCTGCAGATTATATGTATCATTC
GGAAATTGCTGCTCCGGTGTTTTATGACAACTGGGTGGCTCGTGATATCAATGGTACAGCACTCGAAAATGCGCC
TTTTGAAAATATATTTCATCATCCAGAATCGTCTCAACGGTTCCAACGACATCTTCCTGTTCAAGTCCAAAGTTG
TTGGAACGGTATCGCCGTTCTAGATCCTGCACCCTTTTATTCGTATCCTCATGTTCGTTTTCGGATGGCCAAGAT
TACGGAAGGAGAGTGTAGTGCGAGTGAATGTAGTTTGATATGTAATGATTATTGGGAAGCTGGGTATGGTAGGAT
TTTAATGGTGCCTAGAGTGAAACTTGCATATGACAGCGTAGGTGTTGCTGGCATAAAAAGAAAAATGCCGTTGAC
TGATTCAAATTTTTTTTATTTTAGAGGGTATTTGATATCATTCATCCAGCTAGAAGAAACCTTACCGCTATTCGT
GGGTATGTACGTATGGGTGGATTACCTGAAGATCCACGTACAGATCCACAAGATCGATCATGGTTCGGTCCTCAT
GATCGTTTGTTCACTTCAGAAGAAAGTGAAGAACTTGAATTTATTAATGGACCCGAATACGGTTGGTTCCTAATT
ATCTTTTTTAATCAAATAACCTTTTTCTTATGTTTTTTGTTTTTGAAGTTTGGTGTTGGGGTTGGGATGGAGCTG
GAGATTTGGATGGACCGGATGTAGATCCGATTTGGGAGAGAGTGTCGAATAGGTCGTTGAAACGGGAGGCTGTTT
TGGTTCAACATGATCGTAGTCTTTTATTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail