Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|114770
Gene name
Locationscaffold_09:433186..437133
Strand-
Gene length (bp)3947
Transcript length (bp)3291
Coding sequence length (bp)3291
Protein length (aa) 1097

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04821 TIMELESS Timeless protein 5.5E-75 49 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR92|TOF1_CRYNJ Topoisomerase 1-associated factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TOF1 PE=3 SV=1 33 1027 0.0E+00
sp|P0CR93|TOF1_CRYNB Topoisomerase 1-associated factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TOF1 PE=3 SV=1 33 1027 5.0E-180
sp|Q4PAB2|TOF1_USTMA Topoisomerase 1-associated factor 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TOF1 PE=3 SV=1 6 947 5.0E-85
sp|Q1DM35|TOF1_COCIM Topoisomerase 1-associated factor 1 OS=Coccidioides immitis (strain RS) GN=TOF1 PE=3 SV=1 27 1009 5.0E-74
sp|Q2PIU8|TOF1_ASPOR Topoisomerase 1-associated factor 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tof1 PE=3 SV=1 35 1080 5.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR92|TOF1_CRYNJ Topoisomerase 1-associated factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TOF1 PE=3 SV=1 33 1027 0.0E+00
sp|P0CR93|TOF1_CRYNB Topoisomerase 1-associated factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TOF1 PE=3 SV=1 33 1027 5.0E-180
sp|Q4PAB2|TOF1_USTMA Topoisomerase 1-associated factor 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TOF1 PE=3 SV=1 6 947 5.0E-85
sp|Q1DM35|TOF1_COCIM Topoisomerase 1-associated factor 1 OS=Coccidioides immitis (strain RS) GN=TOF1 PE=3 SV=1 27 1009 5.0E-74
sp|Q2PIU8|TOF1_ASPOR Topoisomerase 1-associated factor 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tof1 PE=3 SV=1 35 1080 5.0E-74
sp|A1C928|TOF1_ASPCL Topoisomerase 1-associated factor 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tof1 PE=3 SV=1 35 928 7.0E-71
sp|Q5AXH3|TOF1_EMENI Topoisomerase 1-associated factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tof1 PE=3 SV=2 29 923 1.0E-69
sp|Q0UJF3|TOF1_PHANO Topoisomerase 1-associated factor 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TOF1 PE=3 SV=1 35 949 4.0E-68
sp|A1D9I5|TOF1_NEOFI Topoisomerase 1-associated factor 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tof1 PE=3 SV=1 35 956 3.0E-67
sp|Q9UUM2|SWI1_SCHPO Mating-type switching protein swi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swi1 PE=1 SV=1 31 1013 6.0E-67
sp|A2R2E3|TOF1_ASPNC Topoisomerase 1-associated factor 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tof1 PE=3 SV=2 35 927 8.0E-66
sp|Q0CU99|TOF1_ASPTN Topoisomerase 1-associated factor 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tof1 PE=3 SV=1 35 957 1.0E-63
sp|Q4W9M7|TOF1_ASPFU Topoisomerase 1-associated factor 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tof1 PE=3 SV=2 35 956 2.0E-63
sp|A4R4R3|TOF1_MAGO7 Topoisomerase 1-associated factor 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TOF1 PE=3 SV=1 28 922 3.0E-50
sp|Q6CFJ2|TOF1_YARLI Topoisomerase 1-associated factor 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TOF1 PE=3 SV=1 35 804 6.0E-47
sp|Q7S2A9|TOF1_NEUCR Topoisomerase 1-associated factor 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tof-1 PE=3 SV=1 28 964 4.0E-46
sp|Q2HBI0|TOF1_CHAGB Topoisomerase 1-associated factor 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TOF1 PE=3 SV=1 23 956 4.0E-44
sp|A5DJ85|TOF1_PICGU Topoisomerase 1-associated factor 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TOF1 PE=3 SV=2 23 814 5.0E-40
sp|A5E2H7|TOF1_LODEL Topoisomerase 1-associated factor 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TOF1 PE=3 SV=2 23 743 3.0E-35
sp|Q6FNX7|TOF1_CANGA Topoisomerase 1-associated factor 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TOF1 PE=3 SV=1 35 807 5.0E-35
sp|Q59NW5|TOF1_CANAL Topoisomerase 1-associated factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TOF1 PE=3 SV=1 23 804 6.0E-34
sp|Q6BPI8|TOF1_DEBHA Topoisomerase 1-associated factor 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TOF1 PE=3 SV=2 1 816 1.0E-31
sp|P53840|TOF1_YEAST Topoisomerase 1-associated factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOF1 PE=1 SV=1 35 803 1.0E-28
sp|A3LR41|TOF1_PICST Topoisomerase 1-associated factor 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TOF1 PE=3 SV=2 23 959 6.0E-28
sp|Q6CUU2|TOF1_KLULA Topoisomerase 1-associated factor 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TOF1 PE=3 SV=1 1 795 4.0E-27
sp|Q752A3|TOF1_ASHGO Topoisomerase 1-associated factor 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOF1 PE=3 SV=2 22 940 7.0E-23
sp|Q9UNS1|TIM_HUMAN Protein timeless homolog OS=Homo sapiens GN=TIMELESS PE=1 SV=2 35 579 6.0E-11
sp|Q9R1X4|TIM_MOUSE Protein timeless homolog OS=Mus musculus GN=Timeless PE=1 SV=3 35 577 7.0E-09
sp|Q9Z2Y1|TIM_RAT Protein timeless homolog OS=Rattus norvegicus GN=Timeless PE=1 SV=1 35 577 2.0E-07
sp|Q9UNS1|TIM_HUMAN Protein timeless homolog OS=Homo sapiens GN=TIMELESS PE=1 SV=2 617 734 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|114770
MAEVIDLTTLDDADNQEDSRHENQYDAHETIEPVITTIIDALGGVEQGKYRMGEQAGACLKDLKKLWRRDDTDDD
RTVARIFWEKRLLQNDLVPILLATAGEGLGDDKRAISCVDLMTAMTWPIDMAEELKELDDEEDKNADFTQLVESH
LYYKSSLVRPDIMKALFNIIISPLSKSIPERSERDCQIVTVVLYLIRNLAFVQDLRPGANLSANQLEFTSLQSRL
IKELSASNFLEFILTISSNSEKDPWLTGWNTVALEILYLFYRGVSPVSLSTKQIDQPREKLQRLLNTESRLRREA
YSNPSTRHSRFGTTISIIRNPKRKQNEGDPPPQASVLHRQQALNKEAVDILDIKKRQNVRKGNTVDALSREDNLS
VDARVKLQELANEFLKACFNSFVATLLKDIRLERARITEKDKLRLLFVTKFFLDYFLALRAQEQQSQMDKDTSNV
DEKWPFGLIAEVMERDWIVWVLKRMREAVDEKPKLWNELQAGIECLTQLLLLIDTMSRSTITDSTLAEAADLLQQ
QIIYNGDILDIAMDSLRAYRPGSQSLAYLDTSIHLAYVLMRILERWSKGKGDGVYVRRKTVRRQRKAKGVTEEEG
IPDAEDEEAIEKEEDIIQETLFTFDAFEMKFANADINQTLLIYLTRYKEFESPDQMRRVVSLLHRQAVKAKAEGL
FFNVSTLDLFKTIVAEKTSLPRDQPYKDLISLINFILRKFFKSLAEDAFLAVEVFFPKNRGHWKQYSSWEADEHS
MKKKKKGRAGVVEEELETRFPPDVHVKKGYSWSDQLGIVIAALVEADLTGLVNWTKEILASVGERRRKIIIESDI
DEEDDQMREDEDDDDDDDGDKSLRKDRPSAKKTITDYEIPYLNDEHAKAATRNSELKLLFRLCKFDVRNEEDEDE
LQWYVPAAVLPADLEATLNVINQFMEKPIDLEGKKASSLLNKKRRRRRRQRNESDEEEEEEVQSKRKEKKKKEKE
QYKSAQFIQDSDEEYGDMDTFLEKEKMVREKAELAGAAAVSGQGVRPIGMRAHGRKQKKKKEKVDDERRRLSTSL
TSDESDEDEDRRSALPRQSSSPGEADKEVSRREGRRKMVIISDEEE*
Coding >Agabi119p4|114770
ATGGCAGAGGTCATCGATCTCACCACCCTCGACGACGCCGACAATCAGGAGGACAGCCGACACGAGAACCAGTAT
GATGCTCACGAGACTATCGAGCCCGTCATCACCACCATCATCGATGCACTTGGTGGTGTGGAGCAGGGCAAATAT
CGCATGGGGGAACAGGCCGGTGCCTGTCTCAAAGATCTAAAGAAGCTCTGGAGACGCGACGATACGGACGATGAC
CGCACTGTCGCACGCATCTTCTGGGAGAAACGACTGTTGCAGAATGATCTTGTCCCCATCCTTCTTGCGACCGCA
GGCGAAGGACTTGGAGACGACAAGCGCGCCATTTCATGTGTGGACCTCATGACTGCTATGACTTGGCCTATCGAC
ATGGCAGAAGAACTCAAAGAGCTCGATGATGAGGAAGACAAGAATGCCGACTTTACTCAACTCGTTGAAAGTCAT
CTGTATTACAAATCTTCGCTCGTTCGCCCCGATATCATGAAGGCTCTATTCAACATCATAATATCCCCGCTATCA
AAATCCATACCAGAACGATCGGAGAGAGATTGTCAGATTGTCACTGTTGTGCTATATCTCATACGAAATCTCGCC
TTTGTTCAAGATCTCCGTCCAGGCGCCAATCTCAGTGCAAACCAACTCGAATTCACATCTCTCCAATCTCGACTT
ATCAAAGAACTTTCTGCGTCCAACTTTCTTGAATTTATCTTGACCATTTCGTCCAACTCTGAGAAAGATCCCTGG
CTTACCGGCTGGAATACAGTCGCGCTCGAAATACTTTACCTGTTCTATCGGGGAGTCAGCCCAGTCTCTTTGTCA
ACGAAACAAATTGATCAACCTAGAGAAAAATTACAACGACTACTCAATACGGAGTCTCGTCTCCGGCGCGAAGCC
TACTCTAACCCTTCAACCCGTCATTCTCGGTTCGGTACAACCATTTCCATTATTCGCAATCCCAAGAGGAAGCAA
AATGAAGGCGATCCCCCGCCTCAAGCATCGGTGCTTCATCGACAACAAGCTCTGAATAAAGAAGCTGTGGATATA
TTGGACATCAAAAAGCGTCAAAACGTACGCAAGGGTAATACGGTAGATGCACTTTCCCGAGAGGACAACCTCTCC
GTGGATGCCCGCGTGAAATTACAAGAACTTGCCAATGAATTCCTTAAAGCTTGTTTCAATTCTTTTGTAGCAACG
CTACTGAAAGATATTAGATTGGAGAGAGCGAGGATTACGGAGAAGGATAAGCTACGTCTGTTGTTTGTCACTAAA
TTTTTCCTCGATTACTTTCTTGCCTTGCGTGCTCAAGAGCAACAATCACAAATGGATAAGGACACGTCTAATGTG
GACGAGAAGTGGCCTTTCGGGCTCATCGCCGAAGTTATGGAGCGAGATTGGATTGTCTGGGTTCTCAAGCGTATG
CGTGAAGCCGTCGATGAGAAGCCCAAACTGTGGAACGAGCTTCAAGCAGGCATCGAATGTTTAACCCAACTCTTA
CTTCTCATTGACACCATGTCAAGGTCGACTATCACCGATTCTACGTTAGCCGAAGCCGCGGACCTGTTGCAACAA
CAGATTATCTATAATGGCGATATTTTGGATATTGCGATGGACAGTTTGCGTGCTTATAGGCCGGGATCACAATCG
TTGGCTTACCTTGATACGAGTATTCATTTGGCTTACGTGTTGATGCGCATTTTAGAAAGGTGGTCAAAAGGCAAA
GGTGATGGAGTTTATGTGCGTCGGAAAACTGTTCGGAGGCAGAGGAAAGCCAAAGGTGTCACAGAAGAAGAAGGT
ATCCCCGATGCCGAAGATGAAGAAGCCATTGAGAAAGAGGAAGATATTATTCAAGAAACCCTCTTTACCTTCGAT
GCATTTGAAATGAAATTCGCTAATGCGGATATAAACCAAACGCTTCTGATATATCTGACTCGATACAAGGAATTT
GAATCTCCTGATCAAATGCGACGGGTTGTTAGCCTACTTCATAGGCAAGCTGTCAAAGCCAAGGCAGAAGGATTG
TTCTTCAATGTGTCGACGTTAGACCTTTTCAAGACGATTGTGGCGGAGAAGACTAGTTTGCCTCGAGATCAGCCG
TATAAGGATCTGATTAGTCTCATCAATTTCATTCTACGCAAATTCTTCAAGTCACTTGCTGAAGATGCTTTCCTT
GCAGTCGAGGTGTTCTTCCCGAAAAATCGAGGGCATTGGAAACAGTACTCCAGTTGGGAAGCAGATGAACATTCA
ATGAAGAAGAAGAAGAAGGGTAGAGCAGGCGTGGTGGAAGAAGAATTGGAAACGAGATTCCCACCAGATGTTCAT
GTCAAGAAGGGATACTCTTGGAGTGATCAACTTGGCATCGTCATAGCCGCCCTTGTAGAGGCCGATTTAACCGGA
TTGGTGAATTGGACTAAGGAGATATTGGCTAGTGTGGGAGAACGGCGGCGAAAGATCATTATTGAGAGTGATATT
GACGAGGAAGATGATCAGATGCGAGAAGATGAGGATGATGATGATGATGATGATGGTGATAAAAGTTTACGCAAG
GATCGACCATCAGCGAAGAAGACCATCACGGATTATGAGATTCCGTATTTGAATGACGAACATGCGAAGGCTGCG
ACGAGGAATTCTGAATTGAAATTGTTGTTCCGGTTATGCAAGTTTGATGTAAGGAATGAAGAAGATGAGGATGAG
TTGCAGTGGTATGTTCCTGCAGCGGTGCTTCCTGCCGATTTAGAGGCGACGTTGAACGTCATCAATCAATTTATG
GAGAAGCCGATTGATTTGGAAGGAAAGAAAGCTTCGTCGTTGTTGAATAAGAAAAGGAGGAGGAGAAGAAGACAG
AGGAATGAATCTGACGAGGAGGAGGAGGAGGAAGTACAATCGAAACGAAAGGAGAAGAAGAAGAAGGAAAAGGAG
CAATATAAATCGGCACAGTTTATTCAAGATAGCGATGAAGAATATGGGGATATGGATACATTTTTGGAAAAGGAG
AAAATGGTACGGGAAAAGGCTGAATTGGCTGGAGCTGCGGCGGTTTCGGGGCAGGGTGTGCGACCGATTGGGATG
CGGGCGCATGGTAGGAAACAGAAGAAGAAAAAGGAAAAGGTGGACGATGAGAGGCGGAGATTGTCGACTTCATTA
ACGTCGGATGAGAGTGATGAGGATGAGGACCGTCGTTCGGCCCTACCTCGGCAGAGTTCATCTCCTGGTGAAGCG
GACAAGGAGGTCTCTAGGCGTGAAGGGAGAAGGAAAATGGTTATAATTTCTGATGAGGAAGAGTAG
Transcript >Agabi119p4|114770
ATGGCAGAGGTCATCGATCTCACCACCCTCGACGACGCCGACAATCAGGAGGACAGCCGACACGAGAACCAGTAT
GATGCTCACGAGACTATCGAGCCCGTCATCACCACCATCATCGATGCACTTGGTGGTGTGGAGCAGGGCAAATAT
CGCATGGGGGAACAGGCCGGTGCCTGTCTCAAAGATCTAAAGAAGCTCTGGAGACGCGACGATACGGACGATGAC
CGCACTGTCGCACGCATCTTCTGGGAGAAACGACTGTTGCAGAATGATCTTGTCCCCATCCTTCTTGCGACCGCA
GGCGAAGGACTTGGAGACGACAAGCGCGCCATTTCATGTGTGGACCTCATGACTGCTATGACTTGGCCTATCGAC
ATGGCAGAAGAACTCAAAGAGCTCGATGATGAGGAAGACAAGAATGCCGACTTTACTCAACTCGTTGAAAGTCAT
CTGTATTACAAATCTTCGCTCGTTCGCCCCGATATCATGAAGGCTCTATTCAACATCATAATATCCCCGCTATCA
AAATCCATACCAGAACGATCGGAGAGAGATTGTCAGATTGTCACTGTTGTGCTATATCTCATACGAAATCTCGCC
TTTGTTCAAGATCTCCGTCCAGGCGCCAATCTCAGTGCAAACCAACTCGAATTCACATCTCTCCAATCTCGACTT
ATCAAAGAACTTTCTGCGTCCAACTTTCTTGAATTTATCTTGACCATTTCGTCCAACTCTGAGAAAGATCCCTGG
CTTACCGGCTGGAATACAGTCGCGCTCGAAATACTTTACCTGTTCTATCGGGGAGTCAGCCCAGTCTCTTTGTCA
ACGAAACAAATTGATCAACCTAGAGAAAAATTACAACGACTACTCAATACGGAGTCTCGTCTCCGGCGCGAAGCC
TACTCTAACCCTTCAACCCGTCATTCTCGGTTCGGTACAACCATTTCCATTATTCGCAATCCCAAGAGGAAGCAA
AATGAAGGCGATCCCCCGCCTCAAGCATCGGTGCTTCATCGACAACAAGCTCTGAATAAAGAAGCTGTGGATATA
TTGGACATCAAAAAGCGTCAAAACGTACGCAAGGGTAATACGGTAGATGCACTTTCCCGAGAGGACAACCTCTCC
GTGGATGCCCGCGTGAAATTACAAGAACTTGCCAATGAATTCCTTAAAGCTTGTTTCAATTCTTTTGTAGCAACG
CTACTGAAAGATATTAGATTGGAGAGAGCGAGGATTACGGAGAAGGATAAGCTACGTCTGTTGTTTGTCACTAAA
TTTTTCCTCGATTACTTTCTTGCCTTGCGTGCTCAAGAGCAACAATCACAAATGGATAAGGACACGTCTAATGTG
GACGAGAAGTGGCCTTTCGGGCTCATCGCCGAAGTTATGGAGCGAGATTGGATTGTCTGGGTTCTCAAGCGTATG
CGTGAAGCCGTCGATGAGAAGCCCAAACTGTGGAACGAGCTTCAAGCAGGCATCGAATGTTTAACCCAACTCTTA
CTTCTCATTGACACCATGTCAAGGTCGACTATCACCGATTCTACGTTAGCCGAAGCCGCGGACCTGTTGCAACAA
CAGATTATCTATAATGGCGATATTTTGGATATTGCGATGGACAGTTTGCGTGCTTATAGGCCGGGATCACAATCG
TTGGCTTACCTTGATACGAGTATTCATTTGGCTTACGTGTTGATGCGCATTTTAGAAAGGTGGTCAAAAGGCAAA
GGTGATGGAGTTTATGTGCGTCGGAAAACTGTTCGGAGGCAGAGGAAAGCCAAAGGTGTCACAGAAGAAGAAGGT
ATCCCCGATGCCGAAGATGAAGAAGCCATTGAGAAAGAGGAAGATATTATTCAAGAAACCCTCTTTACCTTCGAT
GCATTTGAAATGAAATTCGCTAATGCGGATATAAACCAAACGCTTCTGATATATCTGACTCGATACAAGGAATTT
GAATCTCCTGATCAAATGCGACGGGTTGTTAGCCTACTTCATAGGCAAGCTGTCAAAGCCAAGGCAGAAGGATTG
TTCTTCAATGTGTCGACGTTAGACCTTTTCAAGACGATTGTGGCGGAGAAGACTAGTTTGCCTCGAGATCAGCCG
TATAAGGATCTGATTAGTCTCATCAATTTCATTCTACGCAAATTCTTCAAGTCACTTGCTGAAGATGCTTTCCTT
GCAGTCGAGGTGTTCTTCCCGAAAAATCGAGGGCATTGGAAACAGTACTCCAGTTGGGAAGCAGATGAACATTCA
ATGAAGAAGAAGAAGAAGGGTAGAGCAGGCGTGGTGGAAGAAGAATTGGAAACGAGATTCCCACCAGATGTTCAT
GTCAAGAAGGGATACTCTTGGAGTGATCAACTTGGCATCGTCATAGCCGCCCTTGTAGAGGCCGATTTAACCGGA
TTGGTGAATTGGACTAAGGAGATATTGGCTAGTGTGGGAGAACGGCGGCGAAAGATCATTATTGAGAGTGATATT
GACGAGGAAGATGATCAGATGCGAGAAGATGAGGATGATGATGATGATGATGATGGTGATAAAAGTTTACGCAAG
GATCGACCATCAGCGAAGAAGACCATCACGGATTATGAGATTCCGTATTTGAATGACGAACATGCGAAGGCTGCG
ACGAGGAATTCTGAATTGAAATTGTTGTTCCGGTTATGCAAGTTTGATGTAAGGAATGAAGAAGATGAGGATGAG
TTGCAGTGGTATGTTCCTGCAGCGGTGCTTCCTGCCGATTTAGAGGCGACGTTGAACGTCATCAATCAATTTATG
GAGAAGCCGATTGATTTGGAAGGAAAGAAAGCTTCGTCGTTGTTGAATAAGAAAAGGAGGAGGAGAAGAAGACAG
AGGAATGAATCTGACGAGGAGGAGGAGGAGGAAGTACAATCGAAACGAAAGGAGAAGAAGAAGAAGGAAAAGGAG
CAATATAAATCGGCACAGTTTATTCAAGATAGCGATGAAGAATATGGGGATATGGATACATTTTTGGAAAAGGAG
AAAATGGTACGGGAAAAGGCTGAATTGGCTGGAGCTGCGGCGGTTTCGGGGCAGGGTGTGCGACCGATTGGGATG
CGGGCGCATGGTAGGAAACAGAAGAAGAAAAAGGAAAAGGTGGACGATGAGAGGCGGAGATTGTCGACTTCATTA
ACGTCGGATGAGAGTGATGAGGATGAGGACCGTCGTTCGGCCCTACCTCGGCAGAGTTCATCTCCTGGTGAAGCG
GACAAGGAGGTCTCTAGGCGTGAAGGGAGAAGGAAAATGGTTATAATTTCTGATGAGGAAGAGTAG
Gene >Agabi119p4|114770
ATGGCAGAGGTCATCGATCTCACCACCCTCGACGACGCCGACAATCAGGAGGACAGCCGACACGAGAACCAGTAT
GATGCTCACGAGACTATCGAGCCCGTCATCACCACCATCATCGATGCACTTGGTGGTGTGGAGCAGGGCAAATAT
CGCATGGGGGAACAGGCCGGTGCCTGTCTCAAAGATCTAAAGAAGCTCTGGAGACGCGACGATACGGACGATGAC
CGCACTGTCGCACGCATCTTCTGGGAGAAACGACTGTTGCAGAATGATCTTGTCCCCATCCTTCTTGCGACCGCA
GGCGAAGGACTTGGAGACGACAAGCGCGCCATTTCATGTGTGGACCTCATGACTGCTATGACTTGGCCTATCGAC
ATGGCAGAAGAACTCAAAGAGCTCGATGATGAGGAAGACAAGAATGCCGACTTTACTCAACTCGTTGAAAGTCAT
CTGTATTACAAATCTTCGCTCGTTCGCCCCGATATCATGAAGGCTCTATTCAACATCATAATATCCCCGCTATCA
AAATCCATACCAGAACGATCGGAGAGAGATTGTCAGATTGTCACTGTTGTGCTATATCTCATACGAAATCTCGCC
TTTGTTCAAGATCTCCGTCCAGGCGCCAATCTCAGTGCAAACCAACTCGAATTCACATCTCTCCAATCTCGACTT
ATCAAAGAACTTTCTGCGTCCAACTTTCTTGAATTTATCTTGACCATTTCGTCCAACTCTGAGAAAGATCCCTGG
CTTACCGGCTGGAATACAGTCGCGCTCGAAATACTTTACCTGTTCTATCGGGGAGTCAGCCCAGTCTCTTTGTCA
ACGAAACAAATTGATGTACGTAGTCTGTTGATAAATATAGCCTGCCTTAATGCTGGCGCAGCAACCTAGAGAAAA
ATTACAACGACTACTCAATACGGAGTCTCGTCTCCGGCGCGAAGCCTACTCTAACCCTTCAACCCGTCATTCTCG
GTTCGGTACAACCATTTCCATTATTCGCAATCCCAAGAGGAAGCAAAATGAAGGCGATCCCCCGCCTCAAGCATC
GGTGCTTCATCGACAACAAGCTCTGAATAAAGAAGCTGTGGATATATTGGACATCAAAAAGCGTCAAAACGTACG
CAAGGGTAATACGGTAGATGCACTTTCCCGAGAGGACAACCTCTCCGTGGATGCCCGCGTGAAATTACAAGAACT
TGCCAATGAATTCCTTAAAGCTTGTTTCAATTGTGAGTTGCGGTAGCTTCCCTTTTACAAAATTTCATTGCTGAG
ATCTTCGGGAACGATCTCTCCAGCTTTTGTAGCAACGCTACTGAAAGATATTAGATTGGAGAGAGCGAGGATTAC
GGAGAAGGATAAGCTACGTCTGTTGTTTGTCACTAAATTTTTCCTCGATTACTTTCTTGCCTTGCGTGCTCAAGA
GCAACAATCACAAATGGATAAGGACACGTCTAATGTGGACGAGAAGTGGCCTTTCGGGCTCATCGCCGAAGTTAT
GGAGCGAGATTGGATTGTCTGGGTTCTCAAGCGTATGCGTGAAGCCGTCGATGAGAAGGTAGACAACCTCTTTGT
TTTTGTTTCTCACTTACTCTTTTTATGGCAGCCCAAACTGTGGAACGAGCTTCAAGCAGGCATCGAATGTTTAAC
CCAACTCTTACTTCTCATTGACACCATGTCAAGGTCGACTATCACCGATTCTACGTTAGCCGAAGCCGCGGACCT
GTTGCAACAACAGATTATCTATAATGGCGATATTTTGGATATTGCGATGGACAGTTTGCGTGCTTATAGGCCGGG
ATCACAATCGTTGGCTTACCTTGATACGAGTATTCATTTGGCTTACGTGTTGATGCGCATTTTAGAAAGGTGGTC
AAAAGGCAAAGGTGATGGAGTTTATGTGCGTCGGAAAACTGTTCGGAGGCAGAGGAAAGCCAAAGGTGTGTAAGT
TTTTTGTTCACGCTATTTCATTAAACCATCATTTTTATTAGGTGTCACAGAAGAAGAAGGTATCCCCGATGCCGA
AGATGAAGAAGCCATTGAGAAAGAGGAAGATATTATTCAAGAAACCCTCTTTACCTTCGATGCATTTGAAATGGT
AGGCATTGACACTAAATCGGGGTTTTGGGGGAAGGTGTTTCATGAACGAGTCTTTTTAGAAATTCGCTAATGCGG
ATATAAACCAAACGCTTCTGATATATCTGACTCGATACAAGGAATTTGAATCTCCTGATCAAATGCGACGGGTTG
TTAGCCTACTTCATAGGCAAGCTGTCAAAGCCAAGGCAGAAGGATTGTTCTTCAATGTTTGTATTGAAAAAAATC
GCCACACCGCTTCATCTCCGAGTTCCCGCTATTAATGCTTATCTTTTGGTTTGGTATAGGTGTCGACGTTAGACC
TTTTCAAGACGATTGTGGCGGAGAAGACTAGTTTGCCTCGAGATCAGCCGTATAAGGATCTGATTAGTCTCATCA
ATTTCATTCTACGCAAATTCTTCAAGTCACTTGCTGAAGATGCTTTCCTTGCAGTCGAGGCATGTATTCGCCGTT
CTCAATAGAAATAAAAATAAAAAAAACTCAATTACTGACAAAAACCCTGGTTACCAAGGTGTTCTTCCCGAAAAA
TCGAGGGCATTGGAAACAGTACTCCAGTTGGGAAGCAGATGAACATTCAATGAAGAAGAAGAAGAAGGGTAGAGC
AGGCGTGGTGGAAGAAGAATTGGAAACGAGATTCCCACCAGATGTTCATGTCAAGAAGGGATACTCTTGGAGTGA
TCAACTTGGCATCGTCATAGCCGCCCTTGTAGAGGCCGATTTAACCGGATTGGTGAATTGGACTAAGGAGGTGCG
TTTGTTATATTTTCTTTTTTTTGGGTGCTGTCATTTTAACTTTTCGGGGTGTGGGTTTTTTTTTTTTTTTTGAAT
TTTGTGTTGACAACGCGGCCGGGTTTAATCCGAAAAAAGATATTGGCTAGTGTGGGAGAACGGCGGCGAAAGATC
ATTATTGAGAGTGATATTGACGAGGAAGATGATCAGATGCGAGAAGATGAGGATGATGATGATGATGATGATGGT
GATAAAAGTTTACGCAAGGATCGACCATCAGCGAAGAAGACCATCACGGATTATGGTGTGGAACCTCATTTTCTC
AACCTTGCAATTTATCGTTCACACATAAATTATAGAGATTCCGTATTTGAATGACGAACATGCGAAGGCTGCGAC
GAGGAATTCTGAATTGAAATTGTTGTTCCGGTTATGCAAGTTTGATGTAAGGAATGAAGAAGGTGTGTGTGTGTA
CTGTGAATTTTATTTATTTTTGATATTGACTAGGGATTTTTATAGATGAGGATGAGTTGCAGTGGTATGTTCCTG
CAGCGGTGCTTCCTGCCGATTTAGAGGCGACGTTGAACGTCATCAATCAATTTATGGAGAAGCCGATTGATTTGG
AAGGAAAGAAAGCTTCGTCGTTGTTGAATAAGAAAAGGAGGAGGAGAAGAAGACAGAGGAATGAATCTGACGAGG
AGGAGGAGGAGGAAGTACAATCGAAACGAAAGGAGAAGAAGAAGAAGGAAAAGGAGCAATATAAATCGGCACAGT
TTATTCAAGATAGCGATGAAGAATATGGGGATATGGATACATTTTTGGAAAAGGAGAAAATGGTACGGGAAAAGG
CTGAATTGGCTGGAGCTGCGGCGGTTTCGGGGCAGGGTGTGCGACCGATTGGGATGCGGGCGCATGGTAGGAAAC
AGAAGAAGAAAAAGGAAAAGGTGGACGATGAGAGGCGGAGATTGTCGACTTCATTAACGTCGGATGAGAGTGATG
AGGATGAGGACCGTCGTTCGGCCCTACCTCGGCAGAGTTCATCTCCTGGTGAAGCGGACAAGGAGGTCTCTAGGC
GTGAAGGGAGAAGGAAAATGGTTATAATTTCTGATGAGGAAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail