Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|114330
Gene name
Locationscaffold_09:314866..318329
Strand-
Gene length (bp)3463
Transcript length (bp)3180
Coding sequence length (bp)3180
Protein length (aa) 1060

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00498 FHA FHA domain 1.6E-04 20 91

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|114330
MKRQEPDTAVTAFGIDTDEVTFGRDPKCSVRLYYSDINLVHCKIIFQERKAFLIVLGPAGLLVDGCRVYPNDSPR
GKPTTIPLSNNSEIEIHGKRFRFSYPPKEIRATLFATPAPSNRKLRLSMIQSAQVFSPAPSKDPRENLRILRSPM
KNTFQSPRKPSPFSQSPITSKMHDGGIEEQDEDEDEEDEEENEDIVLVDGPHPRVVQEEKDLIILEEVDAPAPQA
TVQMQPPKTPQRRRSQSLHRAVLIRSTQRAIIEQERQQQQEEEEREEELEVADTITSADVSTDESSVGTPQSFHD
SPSSDEETESDGGQVQEDTNQDQRKSLWRKSIEKIWPFKNSTTEDSEDNKDEEAEQEEESSGEETEDYERDEGQD
EPEALTSLPQATPIRRPLGSFMTPQVVNKPGPFDRGETPDPSRGRLAGGPPVRYSLGGEARRVPFDSTWRVKDIV
IPVKGEQEDSSLPIPDSAPNPNASPQRPVALGPPQASPTRFRPDVSAEERRAIQERRRSALREVDSGAYFTGIPG
MSPSKASSFASPVKPGFNDSNNPFGPAVVSPSKRESMSPVKEVVSRLSSTDEEDENVDTRSLLERMKETVEGMKR
RRSTLGTSLPSPVKPSSDSNPFENGGLDHFTLNSLEIHDNDDEDKENDRNAMDVDVPAVVLRSPSKELSPVLHLE
TSESSAIDDIAISPNIAQDTTIMELPSQLEEARQSPGQESNQLQAPHTRSRSRTKSPQRTVEPGPVSQATAASEE
PVEAPAPETGDVRGSTTTPGEEEEAPPAVVLPKPRAETRRVRKPTTPEFHQPRNSRQGADAGRKTPTADEGPATA
PKRTSKRTAVKEENVDGPVVPAPPTRRGRPPATTKGATRQKSSERVKRPTSRARSGAKTPVNNDDGDDDSDPLDS
IITSEKTTIVEKPVVHTKSVTIGGRKPGAGVKQEDSPDVLKASTRSKTTTTAAASKTPATATRGRGRPRKTPSTA
PPALTQVINKENTPEAAGSSRTATTRDAATDEGVVVKVRTTARKTRTAIVKQETGLDSSSRGGGVAQTKTRGTRT
TTRARTKTS*
Coding >Agabi119p4|114330
ATGAAAAGACAGGAACCAGACACTGCGGTCACCGCCTTTGGCATCGATACGGACGAAGTCACCTTTGGACGGGAC
CCCAAGTGCAGTGTGCGGCTGTACTACTCCGATATCAACCTTGTTCATTGCAAGATTATCTTTCAAGAACGCAAG
GCATTCCTGATTGTCCTCGGACCTGCGGGTCTTCTCGTCGACGGATGTCGAGTATACCCAAATGACTCGCCTAGA
GGCAAACCAACCACAATCCCGCTTTCAAATAACTCTGAGATCGAGATACACGGGAAACGATTCAGATTCTCTTAT
CCTCCTAAGGAAATCCGAGCCACACTCTTCGCAACGCCTGCACCATCTAATCGAAAACTCCGATTGTCCATGATT
CAGTCTGCACAGGTCTTTTCTCCTGCTCCCTCGAAAGATCCTCGCGAAAATCTCAGAATACTTAGGAGTCCGATG
AAGAATACCTTCCAAAGTCCGAGGAAACCGTCTCCATTCTCTCAGTCGCCGATAACCTCTAAAATGCATGATGGC
GGTATAGAAGAACAGGACGAGGACGAGGACGAGGAGGATGAGGAAGAAAATGAAGATATTGTACTAGTCGACGGT
CCTCATCCACGTGTGGTGCAAGAAGAGAAAGATCTCATCATCCTCGAAGAAGTAGACGCACCTGCTCCTCAAGCT
ACTGTACAGATGCAACCCCCTAAGACGCCACAGCGTCGACGATCGCAGTCCCTTCATCGGGCGGTTCTTATACGG
AGTACCCAACGTGCCATTATAGAGCAGGAACGGCAGCAACAGCAGGAAGAAGAAGAAAGGGAGGAGGAATTGGAA
GTCGCCGACACTATCACTAGCGCCGATGTTAGCACTGACGAGAGTTCTGTTGGGACCCCTCAGAGTTTTCACGAT
TCTCCGTCCTCAGATGAAGAAACGGAAAGCGACGGAGGTCAGGTACAGGAAGACACAAATCAAGACCAACGGAAG
TCACTCTGGCGAAAAAGTATCGAAAAGATATGGCCCTTCAAAAACTCAACCACAGAAGACTCCGAGGATAACAAG
GATGAAGAGGCGGAACAGGAAGAGGAAAGTTCGGGAGAAGAAACAGAAGACTATGAGAGGGATGAGGGCCAAGAT
GAACCAGAAGCATTAACTTCTTTACCTCAAGCCACACCAATCCGTCGTCCCCTGGGTTCCTTCATGACACCTCAA
GTTGTGAACAAACCTGGCCCGTTCGACCGCGGAGAGACTCCCGATCCATCTCGAGGCCGGCTTGCAGGAGGTCCT
CCGGTTCGATATTCTCTAGGTGGAGAGGCTAGAAGAGTACCTTTCGACTCCACCTGGCGCGTTAAAGATATAGTT
ATCCCTGTAAAGGGAGAGCAAGAAGACTCATCTCTACCAATACCTGATAGTGCTCCCAACCCGAACGCCAGTCCA
CAGCGACCAGTCGCTCTAGGTCCACCTCAGGCATCGCCTACGCGTTTTCGACCGGATGTTAGTGCAGAAGAACGG
AGAGCAATTCAAGAACGACGACGTAGCGCTCTTCGGGAAGTAGATTCCGGTGCATACTTTACAGGGATTCCTGGG
ATGTCACCTTCAAAAGCATCATCATTTGCATCTCCAGTTAAACCGGGATTCAATGATTCCAATAATCCGTTCGGG
CCGGCCGTTGTTTCTCCTTCCAAACGGGAATCCATGTCTCCAGTCAAGGAAGTGGTAAGCAGGTTGAGTAGTACG
GATGAAGAAGATGAGAATGTGGATACCCGGAGTTTGTTGGAGCGGATGAAGGAAACGGTTGAGGGTATGAAAAGG
AGACGGAGTACCCTCGGTACTTCTCTCCCTAGTCCTGTCAAACCTTCGTCAGATTCGAATCCGTTTGAGAATGGA
GGGCTCGATCATTTCACGCTCAATTCGTTGGAGATTCATGATAATGATGATGAAGACAAAGAGAACGATAGGAAT
GCGATGGATGTCGATGTACCAGCTGTTGTTTTGCGATCTCCGAGCAAGGAGTTGTCTCCGGTGTTGCACCTTGAG
ACATCTGAAAGTTCAGCTATTGATGACATTGCTATCTCTCCAAACATTGCTCAGGATACCACAATCATGGAATTG
CCATCTCAGCTGGAAGAAGCACGACAATCGCCTGGCCAGGAGTCGAATCAGCTTCAAGCCCCTCACACTCGTTCT
CGTTCACGTACAAAGAGCCCACAACGTACAGTTGAACCGGGGCCTGTTTCCCAAGCAACAGCAGCGTCTGAAGAG
CCAGTAGAGGCTCCCGCTCCAGAGACCGGTGACGTGCGTGGATCTACTACTACCCCAGGTGAAGAAGAAGAGGCT
CCTCCAGCTGTTGTTCTTCCAAAGCCAAGAGCAGAAACGAGACGGGTTCGGAAACCGACAACTCCAGAGTTTCAC
CAACCTCGAAATTCTAGACAGGGAGCTGATGCTGGACGGAAAACGCCTACAGCTGACGAAGGCCCTGCCACTGCG
CCTAAGCGTACTTCGAAGAGAACGGCTGTCAAAGAGGAGAACGTCGATGGTCCAGTTGTACCAGCTCCTCCTACA
CGTCGTGGACGACCTCCTGCTACTACCAAAGGCGCTACGAGGCAGAAGAGTAGTGAACGTGTAAAGCGTCCTACT
AGTCGAGCACGGAGTGGTGCCAAGACTCCTGTAAACAATGATGATGGCGACGATGATAGCGACCCTCTGGATTCG
ATAATCACATCTGAGAAAACCACCATTGTTGAAAAACCAGTTGTACATACCAAGTCTGTGACTATTGGCGGTCGG
AAACCGGGAGCAGGTGTGAAGCAGGAAGATTCACCCGACGTGCTGAAGGCTTCCACAAGGTCTAAAACTACGACA
ACTGCCGCTGCATCAAAGACTCCTGCTACTGCTACGAGAGGTCGAGGTCGACCTAGGAAAACTCCCTCTACAGCG
CCGCCTGCTCTCACACAAGTAATCAATAAGGAGAATACTCCGGAGGCAGCTGGATCATCGAGAACGGCTACGACG
AGAGATGCGGCGACAGATGAGGGGGTTGTGGTTAAAGTTAGGACGACGGCGAGAAAGACGAGGACTGCTATTGTT
AAACAAGAAACTGGATTGGACTCTTCTTCACGAGGAGGTGGCGTCGCTCAAACTAAAACTAGGGGGACGCGTACT
ACAACCCGAGCGCGAACGAAAACGAGTTGA
Transcript >Agabi119p4|114330
ATGAAAAGACAGGAACCAGACACTGCGGTCACCGCCTTTGGCATCGATACGGACGAAGTCACCTTTGGACGGGAC
CCCAAGTGCAGTGTGCGGCTGTACTACTCCGATATCAACCTTGTTCATTGCAAGATTATCTTTCAAGAACGCAAG
GCATTCCTGATTGTCCTCGGACCTGCGGGTCTTCTCGTCGACGGATGTCGAGTATACCCAAATGACTCGCCTAGA
GGCAAACCAACCACAATCCCGCTTTCAAATAACTCTGAGATCGAGATACACGGGAAACGATTCAGATTCTCTTAT
CCTCCTAAGGAAATCCGAGCCACACTCTTCGCAACGCCTGCACCATCTAATCGAAAACTCCGATTGTCCATGATT
CAGTCTGCACAGGTCTTTTCTCCTGCTCCCTCGAAAGATCCTCGCGAAAATCTCAGAATACTTAGGAGTCCGATG
AAGAATACCTTCCAAAGTCCGAGGAAACCGTCTCCATTCTCTCAGTCGCCGATAACCTCTAAAATGCATGATGGC
GGTATAGAAGAACAGGACGAGGACGAGGACGAGGAGGATGAGGAAGAAAATGAAGATATTGTACTAGTCGACGGT
CCTCATCCACGTGTGGTGCAAGAAGAGAAAGATCTCATCATCCTCGAAGAAGTAGACGCACCTGCTCCTCAAGCT
ACTGTACAGATGCAACCCCCTAAGACGCCACAGCGTCGACGATCGCAGTCCCTTCATCGGGCGGTTCTTATACGG
AGTACCCAACGTGCCATTATAGAGCAGGAACGGCAGCAACAGCAGGAAGAAGAAGAAAGGGAGGAGGAATTGGAA
GTCGCCGACACTATCACTAGCGCCGATGTTAGCACTGACGAGAGTTCTGTTGGGACCCCTCAGAGTTTTCACGAT
TCTCCGTCCTCAGATGAAGAAACGGAAAGCGACGGAGGTCAGGTACAGGAAGACACAAATCAAGACCAACGGAAG
TCACTCTGGCGAAAAAGTATCGAAAAGATATGGCCCTTCAAAAACTCAACCACAGAAGACTCCGAGGATAACAAG
GATGAAGAGGCGGAACAGGAAGAGGAAAGTTCGGGAGAAGAAACAGAAGACTATGAGAGGGATGAGGGCCAAGAT
GAACCAGAAGCATTAACTTCTTTACCTCAAGCCACACCAATCCGTCGTCCCCTGGGTTCCTTCATGACACCTCAA
GTTGTGAACAAACCTGGCCCGTTCGACCGCGGAGAGACTCCCGATCCATCTCGAGGCCGGCTTGCAGGAGGTCCT
CCGGTTCGATATTCTCTAGGTGGAGAGGCTAGAAGAGTACCTTTCGACTCCACCTGGCGCGTTAAAGATATAGTT
ATCCCTGTAAAGGGAGAGCAAGAAGACTCATCTCTACCAATACCTGATAGTGCTCCCAACCCGAACGCCAGTCCA
CAGCGACCAGTCGCTCTAGGTCCACCTCAGGCATCGCCTACGCGTTTTCGACCGGATGTTAGTGCAGAAGAACGG
AGAGCAATTCAAGAACGACGACGTAGCGCTCTTCGGGAAGTAGATTCCGGTGCATACTTTACAGGGATTCCTGGG
ATGTCACCTTCAAAAGCATCATCATTTGCATCTCCAGTTAAACCGGGATTCAATGATTCCAATAATCCGTTCGGG
CCGGCCGTTGTTTCTCCTTCCAAACGGGAATCCATGTCTCCAGTCAAGGAAGTGGTAAGCAGGTTGAGTAGTACG
GATGAAGAAGATGAGAATGTGGATACCCGGAGTTTGTTGGAGCGGATGAAGGAAACGGTTGAGGGTATGAAAAGG
AGACGGAGTACCCTCGGTACTTCTCTCCCTAGTCCTGTCAAACCTTCGTCAGATTCGAATCCGTTTGAGAATGGA
GGGCTCGATCATTTCACGCTCAATTCGTTGGAGATTCATGATAATGATGATGAAGACAAAGAGAACGATAGGAAT
GCGATGGATGTCGATGTACCAGCTGTTGTTTTGCGATCTCCGAGCAAGGAGTTGTCTCCGGTGTTGCACCTTGAG
ACATCTGAAAGTTCAGCTATTGATGACATTGCTATCTCTCCAAACATTGCTCAGGATACCACAATCATGGAATTG
CCATCTCAGCTGGAAGAAGCACGACAATCGCCTGGCCAGGAGTCGAATCAGCTTCAAGCCCCTCACACTCGTTCT
CGTTCACGTACAAAGAGCCCACAACGTACAGTTGAACCGGGGCCTGTTTCCCAAGCAACAGCAGCGTCTGAAGAG
CCAGTAGAGGCTCCCGCTCCAGAGACCGGTGACGTGCGTGGATCTACTACTACCCCAGGTGAAGAAGAAGAGGCT
CCTCCAGCTGTTGTTCTTCCAAAGCCAAGAGCAGAAACGAGACGGGTTCGGAAACCGACAACTCCAGAGTTTCAC
CAACCTCGAAATTCTAGACAGGGAGCTGATGCTGGACGGAAAACGCCTACAGCTGACGAAGGCCCTGCCACTGCG
CCTAAGCGTACTTCGAAGAGAACGGCTGTCAAAGAGGAGAACGTCGATGGTCCAGTTGTACCAGCTCCTCCTACA
CGTCGTGGACGACCTCCTGCTACTACCAAAGGCGCTACGAGGCAGAAGAGTAGTGAACGTGTAAAGCGTCCTACT
AGTCGAGCACGGAGTGGTGCCAAGACTCCTGTAAACAATGATGATGGCGACGATGATAGCGACCCTCTGGATTCG
ATAATCACATCTGAGAAAACCACCATTGTTGAAAAACCAGTTGTACATACCAAGTCTGTGACTATTGGCGGTCGG
AAACCGGGAGCAGGTGTGAAGCAGGAAGATTCACCCGACGTGCTGAAGGCTTCCACAAGGTCTAAAACTACGACA
ACTGCCGCTGCATCAAAGACTCCTGCTACTGCTACGAGAGGTCGAGGTCGACCTAGGAAAACTCCCTCTACAGCG
CCGCCTGCTCTCACACAAGTAATCAATAAGGAGAATACTCCGGAGGCAGCTGGATCATCGAGAACGGCTACGACG
AGAGATGCGGCGACAGATGAGGGGGTTGTGGTTAAAGTTAGGACGACGGCGAGAAAGACGAGGACTGCTATTGTT
AAACAAGAAACTGGATTGGACTCTTCTTCACGAGGAGGTGGCGTCGCTCAAACTAAAACTAGGGGGACGCGTACT
ACAACCCGAGCGCGAACGAAAACGAGTTGA
Gene >Agabi119p4|114330
ATGAAAAGACAGGAACCAGACACTGCGGTCACCGCCTTTGGCATCGATACGGACGAAGTCACCTTTGGACGGGAC
CCCAAGTGCAGTGTGCGGCTGTACTACTCCGATATCAACCTTGTTCATTGCAAGATTATCTTTCAAGAACGCAAG
GTCGGAAAGATCCCGAGAATATCCCTCTTTTGCATTATCTGACAAATATCTAGGCATTCCTGATTGTCCTCGGAC
CTGCGGGTCTTCTCGTCGACGGATGTCGAGTATACCCAAATGACTCGCCTAGAGGCAAACCAACCACAATCCCGC
TTTCAAATAACTCTGAGATCGAGATACACGGGAAACGATTCAGATTCTCTTATCCTCCTAAGGAAATCCGAGCCA
CACTCTTCGCAACGCCTGCACGTCCGTTTCTTTTCTTTTGTTCATCGAGTTTCACGGCTTACCTTAACGCCATAG
CATCTAATCGAAAACTCCGATTGTCCATGATTCAGTCTGCACAGGTCTTTTCTCCTGCTCCCTCGAAAGATCCTC
GCGAAAATCTCAGAATACTTAGGAGTCCGATGAAGAATACCTTCCAAAGTCCGAGGAAACCGTCTCCATTCTCTC
AGTCGCCGATAACCTCTAAAATGCATGATGGCGGTATAGAAGAACAGGACGAGGACGAGGACGAGGAGGATGAGG
AAGAAAATGAAGATATTGTACTAGTCGACGGTCCTCATCCACGTGTGGTGCAAGAAGAGAAAGATCTCATCATCC
TCGAAGAAGTAGACGCACCTGCTCCTCAAGCTACTGTACAGATGCAACCCCCTAAGACGCCACAGCGTCGACGAT
CGCAGTCCCTTCATCGGGCGGTTCTTATACGGAGTACCCAACGTGCCATTATAGAGCAGGAACGGCAGCAACAGC
AGGAAGAAGAAGAAAGGGAGGAGGAATTGGAAGTCGCCGACACTATCACTAGCGCCGATGTTAGCACTGACGAGA
GTTCTGTTGGGACCCCTCAGAGTTTTCACGATTCTCCGTCCTCAGATGAAGAAACGGAAAGCGACGGAGGTCAGG
TACAGGAAGACACAAATCAAGACCAACGGAAGTCACTCTGGCGAAAAAGTATCGAAAAGATATGGCCCTTCAAAA
ACTCAACCACAGAAGACTCCGAGGTAACTTTTTTTACACAAAGAAATTCACTCTTAAAATGATACGGTTACTGAT
TCATGCTTTAGGATAACAAGGATGAAGAGGCGGAACAGGAAGAGGAAAGTTCGGGAGAAGAAACAGAAGACTATG
AGAGGGATGAGGGCCAAGATGAACCAGAAGCATTAACTTCTTTACCTCAAGCCACACCAATCCGTCGTCCCCTGG
GTTCCTTCATGACACCTCAAGTTGTGAACAAACCTGGCCCGTTCGACCGCGGAGAGACTCCCGATCCATCTCGAG
GCCGGCTTGCAGGAGGTCCTCCGGTTCGATATTCTCTAGGTGGAGAGGCTAGAAGAGTACCTTTCGACTCCACCT
GGCGCGTTAAAGATATAGTTATCCCTGTAAAGGGAGAGCAAGAAGACTCATCTCTACCAATACCTGATAGTGCTC
CCAACCCGAACGCCAGTCCACAGCGACCAGTCGCTCTAGGTCCACCTCAGGCATCGCCTACGCGTTTTCGACCGG
ATGTTAGTGCAGAAGAACGGAGAGTAAGTATTCTCAAACCGTTTTACCCGGGGGCCTCAGATTCTTACAGGGTAC
TATCTAGGCAATTCAAGAACGACGACGTAGCGCTCTTCGGGAAGTAGATTCCGGTGCATACTTTACAGGGATTCC
TGGGATGTCACCTTCAAAAGCATCATCATTTGCATCTCCAGTTAAACCGGGATTCAATGATTCCAATAATCCGTT
CGGGCCGGCCGTTGTTTCTCCTTCCAAACGGGAATCCATGTCTCCAGTCAAGGAAGTGGTAAGCAGGTTGAGTAG
TACGGATGAAGAAGATGAGAATGTGGATACCCGGAGTTTGTTGGAGCGGATGAAGGAAACGGTTGAGGGTATGAA
AAGGAGACGGAGTACCCTCGGTACTTCTCTCCCTAGTCCTGTCAAACCTTCGTCAGATTCGAATCCGTTTGAGAA
TGGAGGGCTCGATCATTTCACGCTCAATTCGTTGGAGATTCATGATAATGATGATGAAGACAAAGAGAACGATAG
GAATGCGATGGATGTCGATGTACCAGCTGTTGTTTTGCGATCTCCGAGCAAGGAGTTGTCTCCGGTGTTGCACCT
TGAGACATCTGAAAGTTCAGCTATTGATGACATTGCTATCTCTCCAAACATTGCTCAGGATACCACAATCATGGA
ATTGCCATCTCAGCTGGAAGAAGCACGACAATCGCCTGGCCAGGTACGCATCTTGTTTCAGCCCTAACTTTCGAT
GACGACGTTAATCGTTTCGTAGGAGTCGAATCAGCTTCAAGCCCCTCACACTCGTTCTCGTTCACGTACAAAGAG
CCCACAACGTACAGTTGAACCGGGGCCTGTTTCCCAAGCAACAGCAGCGTCTGAAGAGCCAGTAGAGGCTCCCGC
TCCAGAGACCGGTGACGTGCGTGGATCTACTACTACCCCAGGTGAAGAAGAAGAGGCTCCTCCAGCTGTTGTTCT
TCCAAAGCCAAGAGCAGAAACGAGACGGGTTCGGAAACCGACAACTCCAGAGTTTCACCAACCTCGAAATTCTAG
ACAGGGAGCTGATGCTGGACGGAAAACGCCTACAGCTGACGAAGGCCCTGCCACTGCGCCTAAGCGTACTTCGAA
GAGAACGGCTGTCAAAGAGGAGAACGTCGATGGTCCAGTTGTACCAGCTCCTCCTACACGTCGTGGACGACCTCC
TGCTACTACCAAAGGCGCTACGAGGCAGAAGAGTAGTGAACGTGTAAAGCGTCCTACTAGTCGAGCACGGAGTGG
TGCCAAGACTCCTGTAAACAATGATGATGGCGACGATGATAGCGACCCTCTGGATTCGATAATCACATCTGAGAA
AACCACCATTGTTGAAAAACCAGTTGTACATACCAAGTCTGTGACTATTGGCGGTCGGAAACCGGGAGCAGGTGT
GAAGCAGGAAGATTCACCCGACGTGCTGAAGGCTTCCACAAGGTCTAAAACTACGACAACTGCCGCTGCATCAAA
GACTCCTGCTACTGCTACGAGAGGTCGAGGTCGACCTAGGAAAACTCCCTCTACAGCGCCGCCTGCTCTCACACA
AGTAATCAATAAGGAGAATACTCCGGAGGCAGCTGGATCATCGAGAACGGCTACGACGAGAGATGCGGCGACAGA
TGAGGGGGTTGTGGTTAAAGTTAGGACGACGGCGAGAAAGACGAGGACTGCTATTGTTAAACAAGAAACTGGATT
GGACTCTTCTTCACGAGGAGGTGGCGTCGCTCAAACTAAAACTAGGGGGACGCGTACTACAACCCGAGCGCGAAC
GAAAACGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail