Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|113470
Gene name
Locationscaffold_08:1819095..1820334
Strand+
Gene length (bp)1239
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ARV2|AIM6_ARTBC Altered inheritance of mitochondria protein 6 homolog ARB_06966 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06966 PE=1 SV=1 29 276 5.0E-35
sp|Q6FWH9|AIM6_CANGA Altered inheritance of mitochondria protein 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AIM6 PE=3 SV=1 14 273 1.0E-20
sp|C5DD45|AIM6_LACTC Altered inheritance of mitochondria protein 6 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=AIM6 PE=3 SV=1 18 278 1.0E-20
sp|Q75E59|AIM6_ASHGO Altered inheritance of mitochondria protein 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AIM6 PE=3 SV=1 31 278 6.0E-18
sp|Q6CQ63|AIM6_KLULA Altered inheritance of mitochondria protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM6 PE=3 SV=1 15 163 5.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ARV2|AIM6_ARTBC Altered inheritance of mitochondria protein 6 homolog ARB_06966 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06966 PE=1 SV=1 29 276 5.0E-35
sp|Q6FWH9|AIM6_CANGA Altered inheritance of mitochondria protein 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AIM6 PE=3 SV=1 14 273 1.0E-20
sp|C5DD45|AIM6_LACTC Altered inheritance of mitochondria protein 6 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=AIM6 PE=3 SV=1 18 278 1.0E-20
sp|Q75E59|AIM6_ASHGO Altered inheritance of mitochondria protein 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AIM6 PE=3 SV=1 31 278 6.0E-18
sp|Q6CQ63|AIM6_KLULA Altered inheritance of mitochondria protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM6 PE=3 SV=1 15 163 5.0E-16
sp|C5DYR9|AIM6_ZYGRC Altered inheritance of mitochondria protein 6 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM6 PE=3 SV=1 18 279 9.0E-16
sp|C8Z6N5|AIM6_YEAS8 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM6 PE=3 SV=1 29 279 3.0E-15
sp|B5VF44|AIM6_YEAS6 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM6 PE=3 SV=1 29 279 3.0E-15
sp|B3LHB3|AIM6_YEAS1 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM6 PE=3 SV=1 29 279 3.0E-15
sp|Q07716|AIM6_YEAST Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM6 PE=1 SV=2 29 279 3.0E-15
sp|C7GJQ6|AIM6_YEAS2 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM6 PE=3 SV=1 29 279 4.0E-15
sp|A6ZX97|AIM6_YEAS7 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM6 PE=3 SV=1 29 279 5.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|113470
MGNPLRTKTVAIKLRTPLVTALLSVCTALPIHSHNDYLQDAPLFTALDVGILSVEADVWLRDGQLYVAHTEGDID
TSKTFQSLYLQPILDIIEGKRDSVTKISVDSPLQLLIDFKSNGDQSYGPVLQALSPLRDAGHLTTFKDGQLVQGA
VTAVGTGNTPLDKVLAATPRDLFYDAHIQDINDTPPAEGVAWGPEIAPLASANFPDVNGILGEAYTFITGNVMGS
THDKLIDLIGTAHSKNMKSRFYGAQDRDGVYLEFLRDGSDYINADRLEYVKDLILNNS*
Coding >Agabi119p4|113470
ATGGGAAACCCGCTGCGCACGAAGACTGTAGCCATCAAATTACGGACACCTCTCGTCACTGCACTGCTGAGCGTA
TGCACGGCTTTGCCCATCCACTCGCACAATGATTACCTCCAGGATGCGCCATTATTCACGGCTCTGGATGTTGGA
ATTCTGAGCGTCGAAGCAGACGTATGGCTTCGAGACGGCCAGCTCTATGTCGCGCACACGGAAGGCGACATTGAC
ACCTCGAAGACTTTCCAGTCACTCTATCTTCAGCCCATCTTGGATATAATAGAGGGAAAGAGAGACTCTGTAACG
AAGATTTCCGTCGACAGTCCTCTCCAACTATTAATTGATTTCAAATCGAATGGTGATCAGTCATATGGTCCCGTC
CTTCAGGCCCTTTCCCCACTTCGCGATGCCGGCCACCTCACTACGTTCAAAGACGGACAACTTGTTCAAGGCGCC
GTCACGGCCGTCGGAACAGGCAATACCCCCTTAGACAAAGTTCTTGCCGCAACGCCAAGAGATTTGTTTTATGAT
GCGCACATTCAGGATATCAACGACACTCCTCCTGCAGAAGGCGTTGCATGGGGACCTGAGATCGCGCCTCTGGCT
AGCGCAAATTTCCCTGATGTGAATGGTATTTTAGGAGAGGCATATACCTTTATTACTGGAAACGTGATGGGGTCT
ACCCATGACAAACTGATTGATTTGATTGGTACGGCACATTCGAAGAATATGAAATCACGGTTCTACGGCGCACAG
GATCGGGATGGGGTATACCTCGAATTTTTGCGCGACGGTTCGGATTACATCAATGCTGATAGGTTGGAATATGTA
AAGGATTTAATCCTCAATAATTCTTGA
Transcript >Agabi119p4|113470
ATGGGAAACCCGCTGCGCACGAAGACTGTAGCCATCAAATTACGGACACCTCTCGTCACTGCACTGCTGAGCGTA
TGCACGGCTTTGCCCATCCACTCGCACAATGATTACCTCCAGGATGCGCCATTATTCACGGCTCTGGATGTTGGA
ATTCTGAGCGTCGAAGCAGACGTATGGCTTCGAGACGGCCAGCTCTATGTCGCGCACACGGAAGGCGACATTGAC
ACCTCGAAGACTTTCCAGTCACTCTATCTTCAGCCCATCTTGGATATAATAGAGGGAAAGAGAGACTCTGTAACG
AAGATTTCCGTCGACAGTCCTCTCCAACTATTAATTGATTTCAAATCGAATGGTGATCAGTCATATGGTCCCGTC
CTTCAGGCCCTTTCCCCACTTCGCGATGCCGGCCACCTCACTACGTTCAAAGACGGACAACTTGTTCAAGGCGCC
GTCACGGCCGTCGGAACAGGCAATACCCCCTTAGACAAAGTTCTTGCCGCAACGCCAAGAGATTTGTTTTATGAT
GCGCACATTCAGGATATCAACGACACTCCTCCTGCAGAAGGCGTTGCATGGGGACCTGAGATCGCGCCTCTGGCT
AGCGCAAATTTCCCTGATGTGAATGGTATTTTAGGAGAGGCATATACCTTTATTACTGGAAACGTGATGGGGTCT
ACCCATGACAAACTGATTGATTTGATTGGTACGGCACATTCGAAGAATATGAAATCACGGTTCTACGGCGCACAG
GATCGGGATGGGGTATACCTCGAATTTTTGCGCGACGGTTCGGATTACATCAATGCTGATAGGTTGGAATATGTA
AAGGATTTAATCCTCAATAATTCTTGA
Gene >Agabi119p4|113470
ATGGGAAACCCGCTGCGCACGAAGACTGTAGCCATCAAATGTCAGAAGCGGTCAAGTAGGACAGGGGCCAGAATA
TAAAGCGGAGTACGGACACCTCTCGGTAACTTGCTCTGACCCTTGCTCCCACTCATGTTCACTTTTGGTCTCAGT
GTTGTAGTCACTGCACTGCTGAGCGTATGCACGGCTTTGCCCATCCACTCGCACAATGATTGTGAGTTTAACCCC
TACCCCTCGTCCTTAGGCCAAGATTTACCCAGTATAATTGTAGACCTCCAGGATGCGCCATTATTCACGGCTCTG
GATGTTGGAATTCTGAGCGTCGAAGCAGACGTATGGCTTCGAGACGGCCAGCTCTATGTAATACACCTCTCTATT
TGCGGGCCTGCCTTCGTTAACGTCATATATCCCACAAGGTCGCGCACACGGAAGGCGACATTGACACCTCGAAGA
CTTTCCAGTCACTCTATCTTCAGCCCATCTTGGATATAATAGAGGGAAAGAGAGACTCTGTAACGAAGTATGTTT
CTTTCCCAAACATCTTGTTTACGCAATTTGTCGAGCAGTGTCGCGAACAGGATTTCCGTCGACAGTCCTCTCCAA
CTATTAATTGATTTCAAATCGAATGGTGATCAGTACGCGCCTTTCCTTTTTCACTTGCTACGTTTCTCTTGTAAC
AATGCTTGACACAGGTCATATGGTCCCGTCCTTCAGGCCCTTTCCCCACTTCGCGATGCCGGCCACCTCACTACG
TTCAAAGACGGACAACTTGTTCAAGGCGCCGTCACGGCCGTCGGAACAGGCAATACCCCCTTAGACAAAGTTCTT
GCCGCAACGCCAAGAGATTTGTTTTATGATGCGCACATTCAGGATATCAACGACACTCCTCCTGCAGAAGGCGTT
GCATGGGGACCTGAGATCGCGCCTCTGGCTAGCGCAAATTTCCCTGATGTGAATGGTATTTTAGGAGAGGTTAAT
ATCCATTTTTCATTCTTCCCCTTGTATTGCTAACAAATGAGCGTCTGTTAGGCATATACCTTTATTACTGGAAAC
GTGATGGGGTCTACCCATGACAAACTGATTGATTTGATTGGTACGGCACATTCGAAGAATATGAAATCACGGTTC
TACGGCGCACAGGATCGGGATGGGGTATACCTCGAATTTTTGCGCGACGGTTCGGATTACATCAATGCTGATAGG
TTGGAATATGTAAAGGATTTAATCCTCAATAATTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail