Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|112890
Gene name
Locationscaffold_08:1714408..1715768
Strand-
Gene length (bp)1360
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 3.8E-11 86 228

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|112890
MLSFRFGTLAILFCAMCTQSLAMPALGNVTSTSPEISMEMFKRAVSAPYVFTAFTSSSESNLYVYTSDDGTDFRL
LKGPTYTPPSGLIRDPSVILHTDGNYYIAYTTDWTGTNFAIASSSNLINWTRLATISTASSVITPVNTWAPEFFK
DPRTGKLNIIVSLSTGSFGPFLPYVFTASDSTLRSWSGPVRMSGISNAGLGYIDTFPLFHNNQYHIFTKAESNGK
KHIEHAVATSLTGPYSFVQTGDFAGWGQAEGPCVTVLPNGRFRLYADGFSSGKYITADSSDLFNWTPFQTIPGLS
GVVRHGTVLKQ*
Coding >Agabi119p4|112890
ATGCTCAGTTTCAGATTCGGCACTTTGGCTATACTTTTTTGTGCAATGTGCACTCAGAGTCTCGCTATGCCTGCT
CTAGGCAACGTGACATCTACAAGCCCGGAAATATCGATGGAGATGTTTAAACGGGCCGTGTCTGCTCCATATGTT
TTCACCGCCTTCACTTCTTCATCTGAATCCAACCTTTACGTTTATACCTCGGATGACGGAACGGATTTCAGATTG
TTAAAAGGACCAACATATACCCCGCCGTCGGGACTAATTCGGGACCCTAGTGTCATTTTGCATACCGATGGGAAT
TACTACATCGCCTATACAACCGACTGGACGGGAACAAACTTCGCCATAGCTAGCAGTTCAAATCTCATCAACTGG
ACGCGGCTTGCGACGATATCAACAGCATCTTCGGTCATAACACCAGTAAATACCTGGGCACCGGAATTTTTCAAG
GATCCTCGGACCGGCAAGCTCAACATCATTGTGTCACTTTCAACCGGAAGTTTTGGCCCATTCCTTCCTTATGTT
TTTACCGCCAGCGATTCGACCTTGAGATCATGGTCTGGTCCAGTCCGAATGTCTGGAATTTCCAACGCTGGACTC
GGGTATATCGACACTTTCCCGCTGTTCCACAATAATCAATATCATATATTTACAAAGGCGGAGTCTAATGGGAAA
AAGCATATTGAACATGCCGTTGCTACTTCATTAACTGGACCATACTCTTTTGTCCAAACTGGTGACTTCGCGGGA
TGGGGCCAAGCCGAAGGACCATGTGTTACTGTTCTTCCCAATGGAAGATTCCGCCTCTACGCCGATGGATTTAGT
TCTGGCAAATATATCACCGCTGACTCTAGCGACCTTTTCAACTGGACTCCGTTCCAGACGATACCTGGTCTCAGT
GGAGTGGTAAGGCATGGGACGGTTTTGAAGCAATGA
Transcript >Agabi119p4|112890
ATGCTCAGTTTCAGATTCGGCACTTTGGCTATACTTTTTTGTGCAATGTGCACTCAGAGTCTCGCTATGCCTGCT
CTAGGCAACGTGACATCTACAAGCCCGGAAATATCGATGGAGATGTTTAAACGGGCCGTGTCTGCTCCATATGTT
TTCACCGCCTTCACTTCTTCATCTGAATCCAACCTTTACGTTTATACCTCGGATGACGGAACGGATTTCAGATTG
TTAAAAGGACCAACATATACCCCGCCGTCGGGACTAATTCGGGACCCTAGTGTCATTTTGCATACCGATGGGAAT
TACTACATCGCCTATACAACCGACTGGACGGGAACAAACTTCGCCATAGCTAGCAGTTCAAATCTCATCAACTGG
ACGCGGCTTGCGACGATATCAACAGCATCTTCGGTCATAACACCAGTAAATACCTGGGCACCGGAATTTTTCAAG
GATCCTCGGACCGGCAAGCTCAACATCATTGTGTCACTTTCAACCGGAAGTTTTGGCCCATTCCTTCCTTATGTT
TTTACCGCCAGCGATTCGACCTTGAGATCATGGTCTGGTCCAGTCCGAATGTCTGGAATTTCCAACGCTGGACTC
GGGTATATCGACACTTTCCCGCTGTTCCACAATAATCAATATCATATATTTACAAAGGCGGAGTCTAATGGGAAA
AAGCATATTGAACATGCCGTTGCTACTTCATTAACTGGACCATACTCTTTTGTCCAAACTGGTGACTTCGCGGGA
TGGGGCCAAGCCGAAGGACCATGTGTTACTGTTCTTCCCAATGGAAGATTCCGCCTCTACGCCGATGGATTTAGT
TCTGGCAAATATATCACCGCTGACTCTAGCGACCTTTTCAACTGGACTCCGTTCCAGACGATACCTGGTCTCAGT
GGAGTGGTAAGGCATGGGACGGTTTTGAAGCAATGA
Gene >Agabi119p4|112890
ATGCTCAGTTTCAGATTCGGCACTTTGGCTATACTTTTTTGTGCAATGTGCACTCAGAGTCTCGCTATGCCTGCT
CTAGGCAACGTGACATCTACAAGCCCGGAAATATCGATGGAGATGTTTAAACGGGCCGTGTCTGCTCCATATGTT
TTCACCGCCTTCACTTCTTCATCTGAATCCAACCTTTACGTTTATACCTCGGATGACGGAACGGATTTCAGATTG
TTAAAAGGACCAACATATACCCCGCCGTCGGGACTAATTCGGGACCCTAGTGTCATTTTGCATACCGAGTATGTG
TACTTATATGCGTATGGCGGGTAATCACACTGATGAAGCATTACAGTGGGAATTACTACATCGCCTGTGAGTCTG
TTGCTGTTATCAAATGGTGAAACAGTCGTCAAGGTTTCTTGTTAAGATACAACCGACTGGACGGGAACAAACTTC
GCCATAGCTGTATGTTGATCTGTTTCGACTCGCCAATACTATCCGCGATGGCGTTGATTGATGGTGTTGATACTT
ATGCGGCTTTTATAGAGCAGTTCAAATCTCATCAACTGGACGCGGCTTGCGACGATATCAACAGCATCTTCGGTC
ATAACACCAGTAAATACCTGGGCACCGGTAAGCTCATAAAAAGTCGTCATGTCCATTCCCACTACTGTCCGCCTG
AAACATTTTTTTAGGAATTTTTCAAGGATCCTCGGACCGGCAAGCTCAACATCATTGTGTCACTTTCAACCGGAA
GTTTTGGCCCATTCCTTCCTTATGTTTTTACCGCCAGCGATTCGACCTTGAGATCATGGTCTGGTCCAGTCCGAA
TGTCTGGAATTTCCAACGCTGGACTCGGGTATATCGACACTTTCCCGCTGTTCCACAAGTAAGTCGACAAATCGT
TTCATAACTCGATTACTTATAGCTGAGATTTATAGTAATCAATATCATATATTTACAAAGGCGGAGTCTAATGGG
AAAAAGCATATTGAACATGCCGTTGCTACTTCATTAACTGGACCATACTCTTTTGTCCAAACTGGTGACTTCGCG
GGATGGGGCCAAGCCGAAGGACCATGTGTTACTGTTCTTCCCAATGGAAGATTCCGCCTGTAAGTGACATCCATA
CTTCGAAGAGTGTTTTATTTTAAAACTCGACTTCTCAGCTACGCCGATGGATTTAGTTCTGGTGAGTGCTCCTGG
GGAAACACCTCCTTCCGGTTAGATGGATGCTAACTCGAGAAAATCATCAACAGGCAAATATATCACCGCTGACTC
TAGCGACCTTTTCAACTGGACTCCGTTCCAGACGATACCTGGTCTCAGTGGAGTGGTAAGGCATGGGACGGTTTT
GAAGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail