Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|112830
Gene name
Locationscaffold_08:1699101..1701124
Strand+
Gene length (bp)2023
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.1E-24 71 204
PF08031 BBE Berberine and berberine like 1.6E-04 452 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 23 335 2.0E-38
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 32 308 9.0E-28
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 73 309 1.0E-17
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 39 256 2.0E-12
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 54 242 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 23 335 2.0E-38
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 32 308 9.0E-28
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 73 309 1.0E-17
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 39 256 2.0E-12
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 54 242 3.0E-12
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 62 236 1.0E-11
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 73 240 1.0E-11
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 134 236 3.0E-11
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 67 240 7.0E-11
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 64 239 5.0E-10
sp|Q796P5|YITY_BACSU Uncharacterized FAD-linked oxidoreductase YitY OS=Bacillus subtilis (strain 168) GN=yitY PE=3 SV=2 91 232 1.0E-09
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 62 236 2.0E-09
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 62 236 6.0E-09
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 72 240 6.0E-08
sp|P10867|GGLO_RAT L-gulonolactone oxidase OS=Rattus norvegicus GN=Gulo PE=1 SV=3 62 236 9.0E-08
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 71 235 9.0E-08
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 71 240 1.0E-07
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 71 315 2.0E-07
sp|Q90YK3|GGLO_SCYTO L-gulonolactone oxidase OS=Scyliorhinus torazame GN=GULO PE=2 SV=1 61 239 3.0E-07
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 72 267 4.0E-07
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 73 235 1.0E-06
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 73 281 3.0E-06
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 72 275 8.0E-06
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 72 240 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|112830
MVSYGLLTPLVLALLVLPRDTLGYAFKRDSICETLKDNISSASKVYYPILNELEYLKGIYHWAISSSQHAECVVE
PGTTSDVANILDILGRTRTPFAVKGGGHTSNPGFSSSEGVQIAMYRFSEIDYNEAEQTVTLGAGLIWDDVYAALE
PYGVNVLGGRVTGLGVAGFTLGGGYSWKTNQYGLTIDTVVAFELVKPDGTVLQVTNETDPDLFFGLKGGFNNFGI
VTKFTLKTFPQTQVWGGLITVTESHIDEINEATADFSANVKDPKAEIITAYNFLLGQPGISQILFYDGPNPPSGI
FDKFMDVPFFTRDVKTRSFLDLVQASPSNVTANQRAIFHTVPVLDYTPSFLNVLLNETIFWGRELSNILELHTGT
FISYAVEPFLPDILTHTDQPSAYPPDRSTRYTPLNVYYTWLAEGNDQLFHDTVKQSVSHLTAAAVNEGQQVQQAP
LYPNYAIYDTPLTKLYGNNLPRLQALKKVHDPDNVMGLAGGFKF*
Coding >Agabi119p4|112830
ATGGTGTCCTATGGCCTTTTGACACCTCTCGTATTGGCTCTGCTAGTCCTTCCGCGCGATACCTTGGGCTATGCT
TTCAAACGGGATTCTATATGTGAAACCCTCAAGGATAACATTTCGTCTGCGTCTAAGGTCTATTATCCCATATTG
AATGAGCTCGAATATCTTAAGGGTATATACCACTGGGCAATTTCAAGTTCACAACACGCGGAATGTGTCGTCGAG
CCTGGGACAACTTCAGATGTAGCAAATATCTTGGATATTCTAGGCCGGACCCGAACACCATTTGCGGTAAAAGGC
GGTGGACATACTTCCAATCCAGGGTTTTCTTCATCCGAAGGAGTCCAAATTGCCATGTATCGATTCTCAGAGATT
GATTACAATGAGGCAGAACAAACAGTAACACTTGGAGCGGGACTTATATGGGACGATGTGTATGCTGCGTTGGAA
CCTTATGGAGTCAATGTTCTCGGTGGACGTGTTACAGGGCTAGGAGTCGCCGGATTTACACTTGGCGGGGGATAT
TCTTGGAAGACCAATCAGTACGGTTTGACTATCGATACAGTCGTCGCATTTGAGCTCGTAAAACCGGATGGAACA
GTGCTTCAGGTGACTAACGAGACAGATCCTGACCTCTTTTTTGGATTGAAGGGCGGTTTCAACAACTTCGGAATT
GTTACAAAATTCACATTAAAGACCTTCCCGCAAACTCAAGTCTGGGGCGGCTTGATTACTGTCACAGAATCTCAC
ATAGACGAAATAAACGAAGCTACTGCTGATTTCTCTGCGAACGTGAAAGATCCAAAAGCCGAGATCATCACAGCA
TACAACTTTCTTCTGGGACAGCCCGGAATTTCTCAAATACTCTTTTACGATGGACCAAACCCACCTAGCGGCATC
TTTGATAAATTTATGGATGTTCCATTTTTCACTAGAGATGTGAAGACTCGTAGTTTCCTTGATTTGGTGCAGGCT
TCTCCCTCTAATGTAACTGCCAACCAAAGAGCCATATTTCACACAGTCCCTGTTTTGGACTATACACCTTCCTTT
TTGAACGTCCTTCTGAATGAAACTATTTTCTGGGGACGAGAGCTCTCAAACATCTTGGAGCTCCACACTGGGACT
TTCATATCTTATGCGGTTGAACCGTTTTTGCCTGATATCCTCACTCACACAGATCAGCCTTCTGCTTACCCTCCA
GATCGTTCCACACGATACACCCCCTTGAACGTCTATTACACTTGGCTCGCCGAAGGAAACGACCAGCTCTTCCAC
GATACTGTCAAGCAAAGTGTTAGCCATTTAACTGCTGCGGCGGTCAATGAAGGCCAACAAGTTCAACAAGCCCCA
CTATATCCAAACTATGCTATTTATGACACTCCTTTGACAAAGCTCTATGGGAACAACCTTCCACGATTGCAAGCG
TTGAAGAAAGTTCATGATCCTGATAACGTTATGGGACTTGCAGGAGGGTTTAAATTTTAG
Transcript >Agabi119p4|112830
ATGGTGTCCTATGGCCTTTTGACACCTCTCGTATTGGCTCTGCTAGTCCTTCCGCGCGATACCTTGGGCTATGCT
TTCAAACGGGATTCTATATGTGAAACCCTCAAGGATAACATTTCGTCTGCGTCTAAGGTCTATTATCCCATATTG
AATGAGCTCGAATATCTTAAGGGTATATACCACTGGGCAATTTCAAGTTCACAACACGCGGAATGTGTCGTCGAG
CCTGGGACAACTTCAGATGTAGCAAATATCTTGGATATTCTAGGCCGGACCCGAACACCATTTGCGGTAAAAGGC
GGTGGACATACTTCCAATCCAGGGTTTTCTTCATCCGAAGGAGTCCAAATTGCCATGTATCGATTCTCAGAGATT
GATTACAATGAGGCAGAACAAACAGTAACACTTGGAGCGGGACTTATATGGGACGATGTGTATGCTGCGTTGGAA
CCTTATGGAGTCAATGTTCTCGGTGGACGTGTTACAGGGCTAGGAGTCGCCGGATTTACACTTGGCGGGGGATAT
TCTTGGAAGACCAATCAGTACGGTTTGACTATCGATACAGTCGTCGCATTTGAGCTCGTAAAACCGGATGGAACA
GTGCTTCAGGTGACTAACGAGACAGATCCTGACCTCTTTTTTGGATTGAAGGGCGGTTTCAACAACTTCGGAATT
GTTACAAAATTCACATTAAAGACCTTCCCGCAAACTCAAGTCTGGGGCGGCTTGATTACTGTCACAGAATCTCAC
ATAGACGAAATAAACGAAGCTACTGCTGATTTCTCTGCGAACGTGAAAGATCCAAAAGCCGAGATCATCACAGCA
TACAACTTTCTTCTGGGACAGCCCGGAATTTCTCAAATACTCTTTTACGATGGACCAAACCCACCTAGCGGCATC
TTTGATAAATTTATGGATGTTCCATTTTTCACTAGAGATGTGAAGACTCGTAGTTTCCTTGATTTGGTGCAGGCT
TCTCCCTCTAATGTAACTGCCAACCAAAGAGCCATATTTCACACAGTCCCTGTTTTGGACTATACACCTTCCTTT
TTGAACGTCCTTCTGAATGAAACTATTTTCTGGGGACGAGAGCTCTCAAACATCTTGGAGCTCCACACTGGGACT
TTCATATCTTATGCGGTTGAACCGTTTTTGCCTGATATCCTCACTCACACAGATCAGCCTTCTGCTTACCCTCCA
GATCGTTCCACACGATACACCCCCTTGAACGTCTATTACACTTGGCTCGCCGAAGGAAACGACCAGCTCTTCCAC
GATACTGTCAAGCAAAGTGTTAGCCATTTAACTGCTGCGGCGGTCAATGAAGGCCAACAAGTTCAACAAGCCCCA
CTATATCCAAACTATGCTATTTATGACACTCCTTTGACAAAGCTCTATGGGAACAACCTTCCACGATTGCAAGCG
TTGAAGAAAGTTCATGATCCTGATAACGTTATGGGACTTGCAGGAGGGTTTAAATTTTAG
Gene >Agabi119p4|112830
ATGGTGTCCTATGGCCTTTTGACACCTCTCGTATTGGCTCTGCTAGTCCTTCCGCGCGATACCTTGGGCTATGCT
TTCAAACGGGATTCTATATGTGAAACCCTCAAGGATAACATTTCGTCTGCGTCTAAGGTCTATTATCCCAGTACG
AGTAACTTTCCTGTTTTTGAAAATTTTCGTCACAACTAAATCGTTTTGTCAGTATTGAATGAGCTCGAATATCTT
AAGGGTATATACCACTGGGCAATTTCAAGTTCACAACACGCGGAATGTGTCGTCGAGCCTGGGACAACTTCAGAT
GTAGCAAATATCGTCCGTGGCCGTTTTCTTCCCTTTGCAACGATGTTCCATGCGCTGACAGTTTTGATCATTTGG
TTAGTTGGATATTCTAGGCCGGACCCGAACACCATTTGCGGTGAGTAACGAACTAGCCATTTGTTTCCAGGTCTA
ACCAGAAGCGTTCCCTAAGGTAAAAGGCGGTGGACATACTTCCAATCCAGGGTTTTCTTCATCCGAAGGAGTCCA
AATTGCCATGTATCGATTCTCAGAGATTGATTACAATGAGGCAGAACAAACAGTAACACTTGGAGCGGGACTTAT
ATGGGACGATGTGTATGCTGCGTTGGAACCTTATGGAGTCAATGTTCTCGGTGGACGTGTTACAGGGCTAGGAGT
CGCCGGATTTACACTTGGCGGGGGTGAGTGAAGCCCATTCCATTCTCCGTCGAGCTCTTTATTCACACGCCGCGC
CGTCAGGATATTCTTGGAAGACCAATCAGTACGGTTTGACTATCGATACAGTCGTCGCATTTGAGCTCGTAAAAC
CGGATGGAACAGTGCTTCAGGTGACTAACGAGACAGATCCTGACCTCTTTTTTGGATTGAAGGTAAGCCAAGTAC
ATTGCCTGATATTTTCTCTAAACCTATTAAAATCAGGGCGGTTTCAACAACTTCGTAGGTGTTATTGCCATTGTC
CTTTCAGCAGAACTGACTTGCGATGTAGGGAATTGTTACAAAATTCACATTAAAGACCTTCCCGCAAACTCAAGT
CTGGGTGAGTAGAAATATTATCAATCACACTCAATGCTGAAAGGGTAAAAAGGGCGGCTTGATTACTGTCACAGA
ATCTCACATAGACGAAATAAACGAAGCTACTGCTGATTTCTCTGCGAACGTGAAAGATCCAAAAGCCGAGATCAT
CACAGCATACAACTTTCTTCTGGGACAGGTAGGTCATTACCGTGCTTGACGGTATATTATCCATTCATCTCAAGA
AAATTAGCCCGGAATTTCTCAAATACTCTTTTACGATGGACCAAACCCACCTAGCGGCATCTTTGATAAATTTAT
GGATGTTCCATTTTTCACTAGAGATGTGAAGACTCGTAGTTTCCTTGATTTGGTGCAGGCTTCTCCCTCTAATGT
AACTGCCAACCAAAGGTAAGGGATAGAGAAAAGAAGCGAATATCATGGCTAACACAGTTTATAGAGCCATATTTC
ACACAGTCCCTGTTTTGGACTATACACCTTCCTTTTTGAACGTCCTTCTGAATGAAACTATTGTGAGAATGTTTT
TTGAGCTCCTGTTTCTTTTACTAATGAACACGATCAAAAGTTCTGGGGACGAGAGCTCTCAAACATCTTGGAGCT
CCACACTGGGACTTTCATATCTTATGCGGTTGAACCGTTTTTGCCTGATATCCTCACTCACACAGATCAGCCTTC
TGCTTACCCTCCAGATCGTTCCACACGATACACCCCCTTGAACGTCTATTACACTTGGCTCGCCGAAGGAAACGA
CCAGCTCTTCCACGATACTGTCAAGCAAAGTGTTAGCCATTTAACTGCTGCGGCGGTCAATGAAGGCCAACAAGT
TCAACAAGCCCCACTATATCCAAACTATGCTATTTATGACACTCCTTTGACAAAGCTCTATGGGAACAACCTTCC
ACGATTGCAAGCGTTGAAGAAAGTTCATGATCCTGATAACGTTATGGGACTTGCAGGAGGGTTTAAATTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail