Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|112680
Gene name
Locationscaffold_08:1658051..1659303
Strand-
Gene length (bp)1252
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05153 MIOX Myo-inositol oxygenase 2.5E-126 55 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z8T3|MIOX_ORYSJ Probable inositol oxygenase OS=Oryza sativa subsp. japonica GN=Os06g0561000 PE=2 SV=1 20 301 2.0E-93
sp|Q8L799|MIOX1_ARATH Inositol oxygenase 1 OS=Arabidopsis thaliana GN=MIOX1 PE=2 SV=1 42 301 2.0E-90
sp|Q54GH4|MIOX_DICDI Inositol oxygenase OS=Dictyostelium discoideum GN=miox PE=3 SV=1 34 301 5.0E-89
sp|Q4V8T0|MIOX_DANRE Inositol oxygenase OS=Danio rerio GN=miox PE=2 SV=1 43 301 2.0E-88
sp|O82200|MIOX2_ARATH Inositol oxygenase 2 OS=Arabidopsis thaliana GN=MIOX2 PE=2 SV=2 40 301 7.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z8T3|MIOX_ORYSJ Probable inositol oxygenase OS=Oryza sativa subsp. japonica GN=Os06g0561000 PE=2 SV=1 20 301 2.0E-93
sp|Q8L799|MIOX1_ARATH Inositol oxygenase 1 OS=Arabidopsis thaliana GN=MIOX1 PE=2 SV=1 42 301 2.0E-90
sp|Q54GH4|MIOX_DICDI Inositol oxygenase OS=Dictyostelium discoideum GN=miox PE=3 SV=1 34 301 5.0E-89
sp|Q4V8T0|MIOX_DANRE Inositol oxygenase OS=Danio rerio GN=miox PE=2 SV=1 43 301 2.0E-88
sp|O82200|MIOX2_ARATH Inositol oxygenase 2 OS=Arabidopsis thaliana GN=MIOX2 PE=2 SV=2 40 301 7.0E-88
sp|Q8H1S0|MIOX4_ARATH Inositol oxygenase 4 OS=Arabidopsis thaliana GN=MIOX4 PE=2 SV=1 42 301 3.0E-87
sp|Q9FJU4|MIOX5_ARATH Inositol oxygenase 5 OS=Arabidopsis thaliana GN=MIOX5 PE=2 SV=1 42 301 8.0E-85
sp|Q5REY9|MIOX_PONAB Inositol oxygenase OS=Pongo abelii GN=MIOX PE=2 SV=1 43 301 3.0E-84
sp|Q9UGB7|MIOX_HUMAN Inositol oxygenase OS=Homo sapiens GN=MIOX PE=1 SV=1 43 301 5.0E-83
sp|Q9QXN4|MIOX_RAT Inositol oxygenase OS=Rattus norvegicus GN=Miox PE=1 SV=2 43 301 1.0E-82
sp|A7MBE4|MIOX_BOVIN Inositol oxygenase OS=Bos taurus GN=MIOX PE=2 SV=1 35 301 1.0E-82
sp|Q8WN98|MIOX_PIG Inositol oxygenase OS=Sus scrofa GN=MIOX PE=1 SV=1 43 301 1.0E-81
sp|Q9QXN5|MIOX_MOUSE Inositol oxygenase OS=Mus musculus GN=Miox PE=1 SV=2 43 301 5.0E-81
[Show less]

GO

GO Term Description Terminal node
GO:0019310 inositol catabolic process Yes
GO:0005737 cytoplasm Yes
GO:0050113 inositol oxygenase activity Yes
GO:0005506 iron ion binding Yes
GO:0044238 primary metabolic process No
GO:0006020 inositol metabolic process No
GO:0019751 polyol metabolic process No
GO:0009987 cellular process No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:1901615 organic hydroxy compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0009056 catabolic process No
GO:0004497 monooxygenase activity No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0044275 cellular carbohydrate catabolic process No
GO:0005575 cellular_component No
GO:0044282 small molecule catabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0046164 alcohol catabolic process No
GO:0044281 small molecule metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0008150 biological_process No
GO:0046914 transition metal ion binding No
GO:0110165 cellular anatomical entity No
GO:0006066 alcohol metabolic process No
GO:0046174 polyol catabolic process No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No
GO:1901616 organic hydroxy compound catabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0003824 catalytic activity No
GO:0044248 cellular catabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|112680
MSVVTEELSYRGRELESISDAIDDVNVLKGKTWSKKSELDENKSKKSFRNYENACDRVKDFYRLQHRKQTVEFNL
KARAAFRNRKRVSMSVWQAIELLNTLVDESDPDTSMSQIEHLLQTAEAIRRDGKPEWMQVTGLLHDLGKLLLLFG
SEGQWDVVGDTFVVGCQFSEKCIYPETFRSNPDSRHPVYSTKFGIYEPNCGLDNVMLCWGHDEYLYQVLKDQCTL
PPEGLAMIRYHSFYPWHREGAYEHLCNENDKKLLAAVQAFNPYDLYSKSDERVNPEKLRPYYEGLIAKFFPPILE
W*
Coding >Agabi119p4|112680
ATGAGCGTCGTTACTGAAGAGCTCAGCTACCGTGGTCGTGAACTTGAAAGTATATCCGACGCTATTGACGATGTC
AACGTTCTGAAGGGGAAAACATGGAGCAAAAAATCCGAACTTGACGAGAACAAAAGCAAAAAAAGTTTTCGTAAC
TACGAAAATGCTTGTGACCGCGTGAAGGATTTCTACCGTTTGCAGCACAGGAAGCAAACCGTCGAGTTTAACTTG
AAAGCTCGTGCCGCATTTCGGAACCGCAAGCGTGTTAGCATGAGCGTTTGGCAAGCCATCGAGCTATTGAACACG
TTGGTTGACGAGTCAGACCCAGACACAAGTATGTCACAAATAGAACATCTACTTCAAACTGCAGAAGCCATTCGA
CGTGATGGTAAACCAGAATGGATGCAGGTAACCGGACTTCTCCATGATTTGGGAAAACTTCTTTTGTTATTCGGT
TCCGAAGGGCAGTGGGATGTTGTAGGAGACACTTTTGTCGTTGGATGCCAGTTTTCCGAAAAATGCATCTATCCC
GAGACCTTCAGGAGTAACCCCGACTCAAGGCACCCCGTTTACTCAACCAAGTTTGGTATATATGAACCAAACTGT
GGGCTGGACAACGTCATGCTTTGTTGGGGTCACGATGAGTATCTCTATCAGGTCCTTAAGGACCAGTGTACCCTT
CCCCCAGAAGGACTTGCCATGATCAGGTATCACAGTTTTTACCCTTGGCACCGCGAAGGCGCATATGAACACCTC
TGCAACGAAAACGATAAAAAGCTCTTGGCAGCTGTGCAAGCTTTCAATCCTTACGACCTCTACAGCAAAAGTGAC
GAACGTGTAAATCCTGAAAAGCTTCGTCCGTACTATGAGGGTCTTATTGCGAAATTTTTCCCTCCTATTCTGGAG
TGGTAG
Transcript >Agabi119p4|112680
ATGAGCGTCGTTACTGAAGAGCTCAGCTACCGTGGTCGTGAACTTGAAAGTATATCCGACGCTATTGACGATGTC
AACGTTCTGAAGGGGAAAACATGGAGCAAAAAATCCGAACTTGACGAGAACAAAAGCAAAAAAAGTTTTCGTAAC
TACGAAAATGCTTGTGACCGCGTGAAGGATTTCTACCGTTTGCAGCACAGGAAGCAAACCGTCGAGTTTAACTTG
AAAGCTCGTGCCGCATTTCGGAACCGCAAGCGTGTTAGCATGAGCGTTTGGCAAGCCATCGAGCTATTGAACACG
TTGGTTGACGAGTCAGACCCAGACACAAGTATGTCACAAATAGAACATCTACTTCAAACTGCAGAAGCCATTCGA
CGTGATGGTAAACCAGAATGGATGCAGGTAACCGGACTTCTCCATGATTTGGGAAAACTTCTTTTGTTATTCGGT
TCCGAAGGGCAGTGGGATGTTGTAGGAGACACTTTTGTCGTTGGATGCCAGTTTTCCGAAAAATGCATCTATCCC
GAGACCTTCAGGAGTAACCCCGACTCAAGGCACCCCGTTTACTCAACCAAGTTTGGTATATATGAACCAAACTGT
GGGCTGGACAACGTCATGCTTTGTTGGGGTCACGATGAGTATCTCTATCAGGTCCTTAAGGACCAGTGTACCCTT
CCCCCAGAAGGACTTGCCATGATCAGGTATCACAGTTTTTACCCTTGGCACCGCGAAGGCGCATATGAACACCTC
TGCAACGAAAACGATAAAAAGCTCTTGGCAGCTGTGCAAGCTTTCAATCCTTACGACCTCTACAGCAAAAGTGAC
GAACGTGTAAATCCTGAAAAGCTTCGTCCGTACTATGAGGGTCTTATTGCGAAATTTTTCCCTCCTATTCTGGAG
TGGTAG
Gene >Agabi119p4|112680
ATGAGCGTCGTTACTGAAGAGCTCAGCTACCGTGGTCGTGAACTTGAAAGTATATCCGACGCTATTGACGATGGT
ATCTTCGCTTACTCGCTCAAATGTGAATAAACACCAATTCGCTGACACTCATCTGTAGTCAACGTTCTGAAGGGG
AAAACATGGAGCAAAAAATCCGAACTTGACGAGAACAAAAGCAAAAAAAGTTTTCGTAACTACGAAAATGCTTGT
GACCGCGTGAAGGATTTCTACCGTTTGCAGCACAGTATGCAATTCCTATTCCTATTTACCACACAGTGATTTTGA
TTATTCATGTACACAGGGAAGCAAACCGTCGAGTTTAACTTGAAAGCTCGTGCCGCATTTCGGAACCGCAAGCGT
GTTAGCATGAGCGTTTGGCAAGCCATCGAGCTATTGAACACGTTGGTTGACGAGTCAGACCCAGACGTCGGTGGT
TTTCATTTCTTCTCGAAATTTTTGTTGCTGACGTGTCAACTCTGCAGACAAGTATGTCACAAATAGAACATCTAC
TTCAAACTGCAGAAGCCATTCGACGTGATGGTAAACCAGAATGGATGCAGGTTTGTCTCGGTGTTTTGCGATCCC
CTGAATCTGGCATGTGCTTATCTCGACACCGTGATCCGCAGGTAACCGGACTTCTCCATGATTTGGGAAAACTTC
TTTTGTTATTCGGTTCCGAAGGGCAGTGGGATGTTGTAGGAGTTAGTTTGGTCAATGTTTCAGTCTCCCTTCAGA
ACGCTAATATCACTCTCAGGACACTTTTGTCGTTGGATGCCAGTTTTCCGAAAAATGCATCTATCCCGAGACCTT
CAGGAGTAACCCCGACTCAAGGCACCCCGTTTACTCAACCAAGTTTGGTATATATGAACCAAACTGTGGGCTGGA
CAACGTCATGCTTTGTTGGGGTCACGATGAGGTAAATTAAATGCCGACTATTCCCATCATATAAATATTCTAAGC
CCCATTCCAGTATCTCTATCAGGTCCTTAAGGACCAGTGTACCCTTCCCCCAGAAGGACTTGCCATGATCAGGTA
TCACAGTTTTTACCCTTGGCACCGCGAAGGCGCATATGAACACCTCTGCAACGAAAACGATAAAAAGCTCTTGGC
AGCTGTGCAAGCTTTCAATCCTTACGACCTCTACAGCAAAAGTGACGAACGTGTAAATCCTGAAAAGCTTCGTCC
GTACTATGAGGGTCTTATTGCGAAATTTTTCCCTCCTATTCTGGAGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail