Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|112600
Gene name
Locationscaffold_08:1630615..1633403
Strand-
Gene length (bp)2788
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02184 HAT HAT (Half-A-TPR) repeat 4.3E-09 187 217

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 5 702 0.0E+00
sp|Q9HF03|CLF1_CRYNH Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CLF1 PE=3 SV=1 5 732 0.0E+00
sp|Q54XP4|CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum GN=crnkl1 PE=3 SV=1 4 691 0.0E+00
sp|Q6C186|CLF1_YARLI Pre-mRNA-splicing factor CLF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CLF1 PE=3 SV=1 8 695 0.0E+00
sp|P17886|CRN_DROME Protein crooked neck OS=Drosophila melanogaster GN=crn PE=2 SV=2 5 694 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 5 702 0.0E+00
sp|Q9HF03|CLF1_CRYNH Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CLF1 PE=3 SV=1 5 732 0.0E+00
sp|Q54XP4|CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum GN=crnkl1 PE=3 SV=1 4 691 0.0E+00
sp|Q6C186|CLF1_YARLI Pre-mRNA-splicing factor CLF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CLF1 PE=3 SV=1 8 695 0.0E+00
sp|P17886|CRN_DROME Protein crooked neck OS=Drosophila melanogaster GN=crn PE=2 SV=2 5 694 0.0E+00
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 6 696 0.0E+00
sp|Q9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens GN=CRNKL1 PE=1 SV=4 5 692 0.0E+00
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 7 675 0.0E+00
sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=1 SV=1 5 702 0.0E+00
sp|Q7SGD2|CLF1_NEUCR Pre-mRNA-splicing factor clf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=clf-1 PE=3 SV=1 1 692 0.0E+00
sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 1 692 0.0E+00
sp|Q5K654|CLF1_PARBR Pre-mRNA-splicing factor CLF1 OS=Paracoccidioides brasiliensis GN=CLF1 PE=3 SV=1 7 703 0.0E+00
sp|Q5BDX1|CLF1_EMENI Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clf1 PE=3 SV=2 7 698 0.0E+00
sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 6 687 0.0E+00
sp|P0CO11|CLF1_CRYNB Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CLF1 PE=3 SV=1 5 685 0.0E+00
sp|P0CO10|CLF1_CRYNJ Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLF1 PE=3 SV=1 5 685 0.0E+00
sp|Q6BSP7|CLF1_DEBHA Pre-mRNA-splicing factor CLF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CLF1 PE=3 SV=2 18 693 8.0E-142
sp|Q5AED6|CLF1_CANAL Pre-mRNA-splicing factor CLF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLF1 PE=3 SV=2 18 691 6.0E-140
sp|Q6CJK2|CLF1_KLULA Pre-mRNA-splicing factor CLF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CLF1 PE=3 SV=1 19 696 3.0E-136
sp|Q12309|CLF1_YEAST Pre-mRNA-splicing factor CLF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLF1 PE=1 SV=1 14 696 2.0E-132
sp|Q750X3|CLF1_ASHGO Pre-mRNA-splicing factor CLF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLF1 PE=3 SV=1 43 696 6.0E-128
sp|Q6FW76|CLF1_CANGA Pre-mRNA-splicing factor CLF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CLF1 PE=3 SV=1 16 692 3.0E-119
sp|A1A5S1|PRP6_RAT Pre-mRNA-processing factor 6 OS=Rattus norvegicus GN=Prpf6 PE=1 SV=1 64 566 3.0E-18
sp|Q2KJJ0|PRP6_BOVIN Pre-mRNA-processing factor 6 OS=Bos taurus GN=PRPF6 PE=2 SV=1 64 566 5.0E-18
sp|Q91YR7|PRP6_MOUSE Pre-mRNA-processing factor 6 OS=Mus musculus GN=Prpf6 PE=1 SV=1 64 566 8.0E-18
sp|O94906|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens GN=PRPF6 PE=1 SV=1 64 566 3.0E-17
sp|Q5RCC2|PRP6_PONAB Pre-mRNA-processing factor 6 OS=Pongo abelii GN=PRPF6 PE=2 SV=1 91 566 7.0E-17
sp|Q9FNS4|MBB1_CHLRE PsbB mRNA maturation factor Mbb1, chloroplastic OS=Chlamydomonas reinhardtii GN=MBB1 PE=2 SV=1 54 264 3.0E-14
sp|Q4WVF4|SYF1_ASPFU Pre-mRNA-splicing factor syf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=syf1 PE=3 SV=1 60 536 1.0E-12
sp|Q7SAK5|SYF1_NEUCR Pre-mRNA-splicing factor syf1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-41 PE=3 SV=1 60 551 5.0E-12
sp|Q9HCS7|SYF1_HUMAN Pre-mRNA-splicing factor SYF1 OS=Homo sapiens GN=XAB2 PE=1 SV=2 66 312 7.0E-12
sp|Q52DF3|SYF1_MAGO7 Pre-mRNA-splicing factor SYF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SYF1 PE=3 SV=2 60 551 1.0E-11
sp|Q9P7R9|SYF1_SCHPO Pre-mRNA-splicing factor cwf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf3 PE=1 SV=1 86 531 1.0E-11
sp|P0CO08|SYF1_CRYNJ Pre-mRNA-splicing factor SYF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SYF1 PE=3 SV=1 87 413 2.0E-11
sp|Q99PK0|SYF1_RAT Pre-mRNA-splicing factor SYF1 OS=Rattus norvegicus GN=Xab2 PE=2 SV=1 66 312 2.0E-11
sp|Q9DCD2|SYF1_MOUSE Pre-mRNA-splicing factor SYF1 OS=Mus musculus GN=Xab2 PE=1 SV=1 66 312 2.0E-11
sp|P0CO09|SYF1_CRYNB Pre-mRNA-splicing factor SYF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SYF1 PE=3 SV=1 87 413 2.0E-11
sp|Q12381|PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp1 PE=1 SV=1 90 534 2.0E-11
sp|Q5RDW9|CSTF3_PONAB Cleavage stimulation factor subunit 3 OS=Pongo abelii GN=CSTF3 PE=2 SV=1 47 568 3.0E-11
sp|Q12996|CSTF3_HUMAN Cleavage stimulation factor subunit 3 OS=Homo sapiens GN=CSTF3 PE=1 SV=1 47 568 5.0E-11
sp|Q99LI7|CSTF3_MOUSE Cleavage stimulation factor subunit 3 OS=Mus musculus GN=Cstf3 PE=1 SV=1 47 568 6.0E-11
sp|Q14690|RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 94 298 1.0E-10
sp|Q12381|PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp1 PE=1 SV=1 74 299 4.0E-10
sp|Q6NS46|RRP5_MOUSE Protein RRP5 homolog OS=Mus musculus GN=Pdcd11 PE=1 SV=2 94 301 5.0E-10
sp|Q8RWG2|CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana GN=HCF107 PE=1 SV=1 55 296 2.0E-09
sp|Q5BH69|SYF1_EMENI Pre-mRNA-splicing factor syf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=syf1 PE=3 SV=1 87 536 3.0E-09
sp|Q8RWG2|CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana GN=HCF107 PE=1 SV=1 57 250 1.0E-08
sp|Q9FNS4|MBB1_CHLRE PsbB mRNA maturation factor Mbb1, chloroplastic OS=Chlamydomonas reinhardtii GN=MBB1 PE=2 SV=1 84 476 1.0E-08
sp|Q8RWG2|CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana GN=HCF107 PE=1 SV=1 60 335 2.0E-08
sp|A7MB10|RRP5_BOVIN Protein RRP5 homolog OS=Bos taurus GN=PDCD11 PE=2 SV=1 111 298 2.0E-08
sp|Q4WXX4|RNA14_ASPFU mRNA 3'-end-processing protein rna14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rna14 PE=3 SV=1 60 156 4.0E-08
sp|Q5B3I8|RNA14_EMENI mRNA 3'-end-processing protein rna14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rna14 PE=3 SV=2 60 156 5.0E-08
sp|Q4WVF4|SYF1_ASPFU Pre-mRNA-splicing factor syf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=syf1 PE=3 SV=1 65 312 8.0E-08
sp|Q9ZT71|STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana GN=STA1 PE=1 SV=1 72 279 1.0E-07
sp|Q99PK0|SYF1_RAT Pre-mRNA-splicing factor SYF1 OS=Rattus norvegicus GN=Xab2 PE=2 SV=1 207 546 2.0E-07
sp|Q9DCD2|SYF1_MOUSE Pre-mRNA-splicing factor SYF1 OS=Mus musculus GN=Xab2 PE=1 SV=1 207 546 2.0E-07
sp|Q9ZT71|STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana GN=STA1 PE=1 SV=1 90 551 2.0E-07
sp|Q9ZT71|STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana GN=STA1 PE=1 SV=1 31 252 2.0E-07
sp|Q9FNS4|MBB1_CHLRE PsbB mRNA maturation factor Mbb1, chloroplastic OS=Chlamydomonas reinhardtii GN=MBB1 PE=2 SV=1 252 598 2.0E-07
sp|Q7S1Y0|RNA14_NEUCR mRNA 3'-end-processing protein rna-14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rna-14 PE=3 SV=1 1 146 2.0E-07
sp|Q9FNS4|MBB1_CHLRE PsbB mRNA maturation factor Mbb1, chloroplastic OS=Chlamydomonas reinhardtii GN=MBB1 PE=2 SV=1 204 572 3.0E-07
sp|Q54Z08|SYF1_DICDI Pre-mRNA-splicing factor SYF1 OS=Dictyostelium discoideum GN=xab2 PE=3 SV=1 65 312 3.0E-07
sp|Q7SAK5|SYF1_NEUCR Pre-mRNA-splicing factor syf1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-41 PE=3 SV=1 43 229 5.0E-07
sp|Q9HCS7|SYF1_HUMAN Pre-mRNA-splicing factor SYF1 OS=Homo sapiens GN=XAB2 PE=1 SV=2 207 546 6.0E-07
sp|Q4P7S1|SYF1_USTMA Pre-mRNA-splicing factor SYF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SYF1 PE=3 SV=1 70 312 8.0E-07
sp|Q7SAK5|SYF1_NEUCR Pre-mRNA-splicing factor syf1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-41 PE=3 SV=1 74 312 1.0E-06
sp|Q04048|SYF1_YEAST Pre-mRNA-splicing factor SYF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYF1 PE=1 SV=1 206 546 2.0E-06
sp|Q5BH69|SYF1_EMENI Pre-mRNA-splicing factor syf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=syf1 PE=3 SV=1 74 312 3.0E-06
sp|P19735|PRP6_YEAST Pre-mRNA-splicing factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP6 PE=1 SV=1 66 265 5.0E-06
sp|Q8RWG2|CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana GN=HCF107 PE=1 SV=1 158 557 5.0E-06
sp|Q9DCD2|SYF1_MOUSE Pre-mRNA-splicing factor SYF1 OS=Mus musculus GN=Xab2 PE=1 SV=1 64 548 6.0E-06
sp|Q5RCC2|PRP6_PONAB Pre-mRNA-processing factor 6 OS=Pongo abelii GN=PRPF6 PE=2 SV=1 74 308 6.0E-06
sp|P0CO09|SYF1_CRYNB Pre-mRNA-splicing factor SYF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SYF1 PE=3 SV=1 70 312 7.0E-06
sp|Q52DF3|SYF1_MAGO7 Pre-mRNA-splicing factor SYF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SYF1 PE=3 SV=2 74 312 7.0E-06
sp|Q99PK0|SYF1_RAT Pre-mRNA-splicing factor SYF1 OS=Rattus norvegicus GN=Xab2 PE=2 SV=1 64 548 7.0E-06
sp|P0CO08|SYF1_CRYNJ Pre-mRNA-splicing factor SYF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SYF1 PE=3 SV=1 70 312 7.0E-06
sp|Q12381|PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp1 PE=1 SV=1 208 560 8.0E-06
sp|P0CO08|SYF1_CRYNJ Pre-mRNA-splicing factor SYF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SYF1 PE=3 SV=1 151 546 8.0E-06
sp|P0CO09|SYF1_CRYNB Pre-mRNA-splicing factor SYF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SYF1 PE=3 SV=1 151 546 8.0E-06
sp|Q2UKV8|RNA14_ASPOR mRNA 3'-end-processing protein rna14 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rna14 PE=3 SV=1 60 156 8.0E-06
sp|Q9ZT71|STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana GN=STA1 PE=1 SV=1 63 297 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0009987 cellular process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|112600
MQDGRAPRVKNRAPAAVQITAEQILREAQERQEPTFRAPKQRVEDFEELSEYQGRKRKEFEERIRRTRGNIREWL
QYANWEASQNAFDRSRSVFERALDVDPRSIQLWFSYTEMELKSRNVQHARNLFDRAVTLLPRVDQLWYKYVYLEE
LLRNIPGARQVFERWMQWEPDDKAWQAYIKMEGRYEELDRASAIYERWVGVRPDPRVWVKWAKFEEERGKVDKAR
EVFQTALEFFGDEEEQVEKAQAVFGAFAKMETRQKEYERARVIYKFALERIPRSKSSGLYASYTKFEKQHGTRST
LENTVLGKRRIQYEEEVAHDGRNYDVWFDYARLEEGALKELRDEGATVEELDAATDRTREVYERAVAQVPPGGEK
RHWRRYIFLWLDYALFEEIESRDYDRARQIYQTAIKLVPHKQFTFAKLWIMFAKFEIRRLDLPVARKILGAAIGM
CPKEALFRGYIDLEVELRDFDRVRQLYQKYLEFDPSNSAAWIRYAELEAQLQDFARTRAIFKLGISQTPLSMPEL
LWKAYIDFEIDEGERDNARELYETLVRQSGHVKVWISYALFEGEPIPVPRAEREEEEEDEEEEVKMAPGNTTTAR
QVFERGYKDLKGRGLKSERVALLETWKTFEESHGTPEDVAKVQAMMPIVSKRRHVDQETGQTVEDWDLVFADDER
EANPTSFKFLQMAHAWKAKSAGAGAAESGARGALAGFVSSSNKSANDQNMDEDDEESDAASSRADDDED*
Coding >Agabi119p4|112600
ATGCAGGACGGCAGAGCGCCCAGGGTAAAAAATCGCGCACCGGCAGCGGTTCAGATCACTGCCGAGCAAATCTTG
CGTGAGGCGCAAGAGCGGCAGGAGCCAACATTTCGGGCACCCAAGCAACGGGTTGAGGACTTTGAAGAACTCAGC
GAATATCAAGGCCGGAAACGAAAGGAATTCGAAGAGCGTATACGGCGAACGCGAGGAAATATAAGAGAATGGCTT
CAGTATGCTAATTGGGAGGCCAGCCAAAATGCTTTCGACCGTTCACGATCTGTCTTTGAGCGCGCTCTCGATGTC
GATCCGCGAAGCATACAACTCTGGTTTTCATACACCGAAATGGAGTTAAAATCGCGGAACGTTCAGCATGCACGA
AACCTCTTTGACAGAGCTGTTACTCTATTACCTCGCGTAGACCAACTCTGGTACAAATATGTCTATCTCGAAGAA
CTCCTGCGCAATATACCTGGAGCTCGTCAAGTATTTGAACGTTGGATGCAATGGGAACCAGACGACAAGGCCTGG
CAAGCTTATATAAAAATGGAAGGGCGGTATGAGGAGCTGGATAGGGCTAGTGCGATATACGAAAGATGGGTTGGC
GTTCGGCCAGACCCACGGGTATGGGTGAAATGGGCCAAGTTTGAAGAGGAGCGGGGAAAGGTGGATAAGGCGCGT
GAGGTATTCCAAACGGCTTTGGAGTTCTTTGGGGATGAGGAAGAGCAGGTGGAGAAGGCCCAGGCCGTATTTGGC
GCCTTCGCTAAAATGGAGACACGTCAGAAGGAGTATGAGCGTGCTCGGGTAATCTACAAGTTCGCCCTCGAACGT
ATACCGAGATCAAAATCCTCCGGTCTATATGCCTCCTACACCAAGTTCGAAAAGCAACATGGTACGCGCTCCACG
CTTGAAAACACGGTTCTCGGTAAGCGTCGAATACAGTATGAGGAAGAAGTGGCGCATGATGGCCGTAATTACGAT
GTCTGGTTTGACTATGCGCGGCTGGAGGAAGGCGCTCTGAAAGAGCTCAGGGACGAAGGCGCTACCGTGGAAGAA
CTAGATGCGGCAACTGATCGTACACGAGAAGTATACGAGCGAGCAGTAGCTCAGGTACCTCCAGGAGGTGAAAAA
CGTCACTGGAGACGGTATATCTTCCTGTGGCTTGACTACGCCTTGTTTGAAGAGATTGAAAGCAGGGACTACGAC
CGCGCTCGACAGATATATCAAACAGCCATCAAGCTCGTACCCCATAAACAATTCACGTTTGCAAAATTATGGATC
ATGTTTGCCAAGTTCGAAATCCGGCGGCTTGATCTGCCAGTGGCAAGGAAAATTCTAGGGGCTGCTATCGGTATG
TGTCCCAAAGAAGCTCTTTTCAGAGGATACATCGATCTGGAAGTGGAGCTGCGAGACTTCGATCGCGTCCGACAA
CTTTATCAAAAATACCTCGAGTTTGATCCCTCAAATTCAGCAGCCTGGATCAGGTACGCCGAGCTCGAAGCGCAA
CTCCAGGATTTCGCTCGTACACGTGCCATATTCAAACTGGGCATATCTCAAACCCCTCTCTCGATGCCCGAGCTT
TTATGGAAAGCTTACATCGATTTCGAAATCGATGAAGGCGAACGTGATAATGCTCGTGAACTTTATGAGACATTG
GTGCGACAAAGTGGACATGTCAAAGTCTGGATTTCGTATGCGTTATTTGAAGGTGAACCTATTCCTGTTCCGAGG
GCTGAGAGAGAGGAGGAAGAAGAAGACGAAGAGGAGGAGGTGAAGATGGCTCCTGGCAATACCACCACCGCCAGG
CAGGTATTTGAGAGGGGCTATAAAGATCTCAAGGGCCGAGGTCTCAAGAGTGAACGAGTCGCCCTTCTCGAAACT
TGGAAAACATTTGAAGAATCACATGGCACACCAGAAGATGTAGCCAAAGTACAAGCAATGATGCCCATCGTCAGT
AAACGTCGTCACGTTGATCAAGAAACTGGTCAAACTGTCGAAGATTGGGATCTCGTATTCGCAGATGATGAGCGG
GAGGCTAATCCCACATCATTCAAGTTTTTACAAATGGCTCATGCTTGGAAAGCCAAATCTGCTGGTGCTGGTGCC
GCTGAGAGCGGTGCACGTGGTGCTCTGGCTGGATTTGTTTCGTCCTCGAACAAGAGTGCAAATGATCAGAATATG
GACGAGGATGATGAGGAAAGTGATGCTGCTAGCTCACGCGCTGATGATGACGAGGATTAG
Transcript >Agabi119p4|112600
ATGCAGGACGGCAGAGCGCCCAGGGTAAAAAATCGCGCACCGGCAGCGGTTCAGATCACTGCCGAGCAAATCTTG
CGTGAGGCGCAAGAGCGGCAGGAGCCAACATTTCGGGCACCCAAGCAACGGGTTGAGGACTTTGAAGAACTCAGC
GAATATCAAGGCCGGAAACGAAAGGAATTCGAAGAGCGTATACGGCGAACGCGAGGAAATATAAGAGAATGGCTT
CAGTATGCTAATTGGGAGGCCAGCCAAAATGCTTTCGACCGTTCACGATCTGTCTTTGAGCGCGCTCTCGATGTC
GATCCGCGAAGCATACAACTCTGGTTTTCATACACCGAAATGGAGTTAAAATCGCGGAACGTTCAGCATGCACGA
AACCTCTTTGACAGAGCTGTTACTCTATTACCTCGCGTAGACCAACTCTGGTACAAATATGTCTATCTCGAAGAA
CTCCTGCGCAATATACCTGGAGCTCGTCAAGTATTTGAACGTTGGATGCAATGGGAACCAGACGACAAGGCCTGG
CAAGCTTATATAAAAATGGAAGGGCGGTATGAGGAGCTGGATAGGGCTAGTGCGATATACGAAAGATGGGTTGGC
GTTCGGCCAGACCCACGGGTATGGGTGAAATGGGCCAAGTTTGAAGAGGAGCGGGGAAAGGTGGATAAGGCGCGT
GAGGTATTCCAAACGGCTTTGGAGTTCTTTGGGGATGAGGAAGAGCAGGTGGAGAAGGCCCAGGCCGTATTTGGC
GCCTTCGCTAAAATGGAGACACGTCAGAAGGAGTATGAGCGTGCTCGGGTAATCTACAAGTTCGCCCTCGAACGT
ATACCGAGATCAAAATCCTCCGGTCTATATGCCTCCTACACCAAGTTCGAAAAGCAACATGGTACGCGCTCCACG
CTTGAAAACACGGTTCTCGGTAAGCGTCGAATACAGTATGAGGAAGAAGTGGCGCATGATGGCCGTAATTACGAT
GTCTGGTTTGACTATGCGCGGCTGGAGGAAGGCGCTCTGAAAGAGCTCAGGGACGAAGGCGCTACCGTGGAAGAA
CTAGATGCGGCAACTGATCGTACACGAGAAGTATACGAGCGAGCAGTAGCTCAGGTACCTCCAGGAGGTGAAAAA
CGTCACTGGAGACGGTATATCTTCCTGTGGCTTGACTACGCCTTGTTTGAAGAGATTGAAAGCAGGGACTACGAC
CGCGCTCGACAGATATATCAAACAGCCATCAAGCTCGTACCCCATAAACAATTCACGTTTGCAAAATTATGGATC
ATGTTTGCCAAGTTCGAAATCCGGCGGCTTGATCTGCCAGTGGCAAGGAAAATTCTAGGGGCTGCTATCGGTATG
TGTCCCAAAGAAGCTCTTTTCAGAGGATACATCGATCTGGAAGTGGAGCTGCGAGACTTCGATCGCGTCCGACAA
CTTTATCAAAAATACCTCGAGTTTGATCCCTCAAATTCAGCAGCCTGGATCAGGTACGCCGAGCTCGAAGCGCAA
CTCCAGGATTTCGCTCGTACACGTGCCATATTCAAACTGGGCATATCTCAAACCCCTCTCTCGATGCCCGAGCTT
TTATGGAAAGCTTACATCGATTTCGAAATCGATGAAGGCGAACGTGATAATGCTCGTGAACTTTATGAGACATTG
GTGCGACAAAGTGGACATGTCAAAGTCTGGATTTCGTATGCGTTATTTGAAGGTGAACCTATTCCTGTTCCGAGG
GCTGAGAGAGAGGAGGAAGAAGAAGACGAAGAGGAGGAGGTGAAGATGGCTCCTGGCAATACCACCACCGCCAGG
CAGGTATTTGAGAGGGGCTATAAAGATCTCAAGGGCCGAGGTCTCAAGAGTGAACGAGTCGCCCTTCTCGAAACT
TGGAAAACATTTGAAGAATCACATGGCACACCAGAAGATGTAGCCAAAGTACAAGCAATGATGCCCATCGTCAGT
AAACGTCGTCACGTTGATCAAGAAACTGGTCAAACTGTCGAAGATTGGGATCTCGTATTCGCAGATGATGAGCGG
GAGGCTAATCCCACATCATTCAAGTTTTTACAAATGGCTCATGCTTGGAAAGCCAAATCTGCTGGTGCTGGTGCC
GCTGAGAGCGGTGCACGTGGTGCTCTGGCTGGATTTGTTTCGTCCTCGAACAAGAGTGCAAATGATCAGAATATG
GACGAGGATGATGAGGAAAGTGATGCTGCTAGCTCACGCGCTGATGATGACGAGGATTAG
Gene >Agabi119p4|112600
ATGCAGGACGGCAGAGCGCCCAGGTAGGCCGCTCTCACCCTCGTCTCGAAACTTTTCTGACAGAAATGCAGGGTA
AAAAATCGCGCACCGGCAGCGGTTCAGGTCAGTATTGGTATTTTGGCTCACAAAGCGCTATACATTACTTAGAGC
TTGCATTCTACTAGATCACTGCCGAGCAAATCTTGCGTGAGGTGGGCAATATTTTCCCTCAGCAGAGCCATGAAG
CTGGATTGATGCAAACTTTATTAGGCGCAAGAGCGGCAGGAGCCAACATTTCGGGCACCCAAGCAACGGGTTGAG
GACTTTGAAGAACTCAGCGAATATCAAGGCCGGAAACGAAAGGAATTCGAAGAGCGTATACGGCGAACGCGAGGA
AATATGTATGTAGAGCTTTTCTCACCTATGCCGAATGCGAGACTCATATCAAATCCAGAAGAGAATGGCTTCAGT
ATGCTAATTGGGAGGTTCGAGAGATATTTGTCTACCTTGCCAACAAGTTGCAAACTGACAACCCGTACCCATAGG
CCAGCCAAAATGCTTTCGACCGTTCACGATCTGTCTTTGAGCGCGCTCTCGATGTCGATCCGCGAAGCATACAAC
TCTGGTTTTCATACACCGAAATGGAGTTAAAATCGCGGAACGTTCAGCATGCACGAAACCTCTTTGACAGAGCTG
TTACTCTATTACCTCGCGTAGACCAACTCTGGTACAAATATGTCTATCTCGAAGAACTCCTGCGCAATATACCTG
GAGCTCGTCAAGTATTTGAACGTTGGATGCAATGGGAACCAGACGACAAGGCCTGGCAAGCTTATATAAAAATGG
AAGGGCGGTATGAGGAGCTGGATAGGGCTAGTGCGATATACGAAAGATGGGTTGGCGTTCGGCCAGACCCACGGG
TATGGGTGAAATGGGCCAAGTTTGAAGAGGAGCGGGGAAAGGTGGATAAGGCGCGTGAGGTATTCCAAACGGCTT
TGGAGTTCTTTGGGGATGAGGAAGAGCAGGTGGAGAAGGCCCAGGCCGTATTTGGCGCCTTCGCTAAAATGGAGA
CACGTCAGAAGGAGTATGAGCGTGCTCGGGTAATCTACAAGGCAAGCTACATCTTCTGCAGTCTTTATCTGGTAT
TGACCAGGTATTAGTTCGCCCTCGAACGTATACCGAGATCAAAATCCTCCGGTCTATATGCCTCCTACACCAAGT
TCGAAAAGCAACATGGTACGCGCTCCACGCTTGAAAACACGGTTCTCGGTAAGCGTCGAATACAGTATGAGGAAG
AAGTGGCGCATGATGGCCGTAATTACGATGTCTGGTTTGACTATGCGCGGCTGGAGGAAGGCGCTCTGAAAGAGC
TCAGGGACGAAGGCGCTACCGTGGAAGAACTAGATGCGGCAACTGATCGTACACGAGAAGTATACGAGCGAGCAG
TAGCTCAGGTACCTCCAGGAGGTGAAAAACGTCACTGGAGACGGTATATCTTCCTGTGGCTTGACTACGCCTTGT
TTGAAGAGATTGAAAGCAGGGTATGAGATTTGAATGTATTTCTGGATATTGGTGCTGAATGTGATCTAGGACTAC
GACCGCGCTCGACAGATATATCAAACAGCCATCAAGCTCGTACCCCATAAACAATTCACGTTTGCAAAATTATGG
ATCATGTTTGCCAAGTTCGAAATCCGGCGGCTTGATCTGCCAGTGGCAAGGAAAATTCTAGGGGCTGCTATCGGT
ATGTGTCCCAAAGAAGCTCTTTTCAGAGGATACATCGATCTGGAAGTGGAGGTATGTATTTTGATGAAAATCTTT
TTCACTTTCTGAGGGTCCTGATGTTTGATCTTTCTAGCTGCGAGACTTCGATCGCGTCCGACAACTTTATCAAAA
ATACCTCGAGGTATCTACTCTTGAATTCATCCAATGTCAAGCGTCAATATTCATGTATTTTTACAGTTTGATCCC
TCAAATTCAGCAGCCTGGATCAGGTACGCCGAGCTCGAAGCGCAACTCCAGGATTTCGCTCGTACACGTGCCATA
TTCAAACTGGGCATATCTCAAACCCCTCTCTCGATGCCCGAGCTTTTATGGAAAGCTTACATCGATTTCGAAATC
GATGAAGGCGAACGTGATAATGCTCGTGAACTTTATGAGACATTGGTGCGACAAAGTGGACATGTCAAAGTCTGG
ATTTCGTATGCGTTATTTGAAGGTGAACCTATTCCTGTTCCGAGGGCTGAGAGAGAGGAGGAAGAAGAAGACGAA
GAGGAGGAGGTGAAGATGGCTCCTGGCAATACCACCACCGCCAGGCAGGTATTTGAGAGGGGCTATAAAGATCTC
AAGGGCCGAGGTCTCAAGAGTGAAGTAAGTCCATTGCCAACCAGCAGTCCATATTCCAACGTGCTCAACCCTATT
TTTATAGCGAGTCGCCCTTCTCGAAACTTGGAAAACATTTGAAGAATCACATGGCACACCAGAAGATGTAGCCAA
AGTACAAGCAATGATGCCCATCGTCAGTAAACGTCGTCACGTTGATCAAGAAACTGGTCAAACTGTCGAAGATTG
GGATCTCGTATTCGCAGATGATGAGCGGGAGGCTAATCCCACATCATTCAAGTTTTTACAAATGGCTCATGCTTG
GAAAGCCAAATCTGCTGGTGCTGGTGCCGCTGAGAGCGGTGCACGTGGTGCTCTGGCTGGATTTGTTTCGTCCTC
GAACAAGAGTGCAAATGATCAGAATATGGACGAGGATGATGAGGAAAGTGATGCTGCTAGCTCACGCGCTGATGA
TGACGAGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail