Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|112390
Gene name
Locationscaffold_08:1570288..1571101
Strand+
Gene length (bp)813
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 1.5E-48 20 224

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 7 225 1.0E-92
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 13 225 1.0E-83

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|112390
MSPIRFASLFLLGATLAAAQCPQVHIFGARETTVPPGYGTAGPVVNSIISAFPGATAEPINYPACGGQASCGGVS
YASSVVQGVAAVARQVNSFNQQCPNAVLVLVGYSQGGQLFDDAYCGGGDSNEGISDPSIPISTAAQAKIAAAIFM
GDPRHIPGLSYNVGTCQASGFAPRPSGFQCPHASTIQSYCDAADPFCCNGNDQNTHQGYAVEYGSAALNFVRGKV
NAMLG*
Coding >Agabi119p4|112390
ATGTCACCCATCCGCTTTGCATCTCTCTTCCTTCTAGGAGCCACTCTCGCTGCTGCCCAGTGTCCACAAGTTCAC
ATCTTTGGCGCGCGTGAGACTACCGTTCCTCCCGGCTACGGCACAGCAGGTCCGGTCGTCAACTCCATCATCTCT
GCATTCCCAGGAGCCACCGCTGAGCCTATTAATTATCCTGCTTGCGGTGGTCAAGCTTCGTGTGGTGGTGTCAGT
TATGCCTCCTCCGTTGTTCAAGGTGTAGCTGCTGTAGCTCGCCAAGTGAATTCTTTCAACCAGCAATGCCCCAAT
GCAGTCTTGGTCTTGGTTGGTTACTCACAGGGCGGTCAACTTTTTGACGATGCGTACTGCGGTGGAGGTGACAGT
AATGAAGGCATCAGCGATCCTTCGATTCCCATTTCTACAGCTGCTCAGGCCAAAATTGCAGCAGCTATCTTCATG
GGCGACCCGCGTCATATCCCTGGTTTGTCCTATAATGTCGGAACCTGTCAAGCGAGTGGCTTTGCTCCTCGACCC
AGTGGCTTCCAGTGCCCACACGCGAGTACCATTCAATCTTACTGCGACGCTGCCGACCCATTCTGCTGCAACGGA
AACGACCAGAACACTCACCAGGGCTACGCTGTTGAGTACGGCTCTGCCGCCCTCAACTTTGTCCGGGGCAAAGTC
AATGCCATGCTTGGTTAA
Transcript >Agabi119p4|112390
ATGTCACCCATCCGCTTTGCATCTCTCTTCCTTCTAGGAGCCACTCTCGCTGCTGCCCAGTGTCCACAAGTTCAC
ATCTTTGGCGCGCGTGAGACTACCGTTCCTCCCGGCTACGGCACAGCAGGTCCGGTCGTCAACTCCATCATCTCT
GCATTCCCAGGAGCCACCGCTGAGCCTATTAATTATCCTGCTTGCGGTGGTCAAGCTTCGTGTGGTGGTGTCAGT
TATGCCTCCTCCGTTGTTCAAGGTGTAGCTGCTGTAGCTCGCCAAGTGAATTCTTTCAACCAGCAATGCCCCAAT
GCAGTCTTGGTCTTGGTTGGTTACTCACAGGGCGGTCAACTTTTTGACGATGCGTACTGCGGTGGAGGTGACAGT
AATGAAGGCATCAGCGATCCTTCGATTCCCATTTCTACAGCTGCTCAGGCCAAAATTGCAGCAGCTATCTTCATG
GGCGACCCGCGTCATATCCCTGGTTTGTCCTATAATGTCGGAACCTGTCAAGCGAGTGGCTTTGCTCCTCGACCC
AGTGGCTTCCAGTGCCCACACGCGAGTACCATTCAATCTTACTGCGACGCTGCCGACCCATTCTGCTGCAACGGA
AACGACCAGAACACTCACCAGGGCTACGCTGTTGAGTACGGCTCTGCCGCCCTCAACTTTGTCCGGGGCAAAGTC
AATGCCATGCTTGGTTAA
Gene >Agabi119p4|112390
ATGTCACCCATCCGCTTTGCATCTCTCTTCCTTCTAGGAGCCACTCTCGCTGCTGCCCAGTGTCCACAAGTTCAC
ATCTTTGGCGCGCGTGAGACTACCGTTCCTCCCGGCTACGGCACAGCAGGTCCGGTCGTCAACTCCATCATCTCT
GCATTCCCAGGAGCCACCGCTGAGCCTATTAATTATCCTGCTTGCGGTGGTCAAGCTTCGTGTGGTGGTGTCAGT
TATGCCTCCTCCGTTGTTCAAGGTGTAGCTGCTGTAGCTCGCCAAGTGAATTCTTTCAACCAGCAATGCCCCAAT
GCAGTCTTGGTCTTGGTTGGTTACTCACAGGTGCTTTGAAGGTCTTTATTTATGCCTTTCGTATATGCTTGCTGA
CATGAGCGCGACAGGGCGGTCAACTTTTTGACGATGCGTACTGCGGTGGAGGTGACAGTAATGAAGGCATCAGCG
ATCCTTCGATTCCCATTTCTACAGCTGCTCAGGCCAAAATTGCAGCAGCTATCTTCATGGGCGACCCGCGTCATA
TCCCTGGTTTGTCCTATAATGTCGGAACCTGTCAAGCGAGTGGCGTTAGTACCCATATATCTGCCTCATCATCTC
TTCATGTCCTGATCTTGATATATCTTCCAGTTTGCTCCTCGACCCAGTGGCTTCCAGTGCCCACACGCGAGTACC
ATTCAATCTTACTGCGACGCTGCCGACCCATTCTGCTGCAACGGAAACGACCAGAACACTCACCAGGGCTACGCT
GTTGAGTACGGCTCTGCCGCCCTCAACTTTGTCCGGGGCAAAGTCAATGCCATGCTTGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail