Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|112330
Gene name
Locationscaffold_08:1553938..1560342
Strand+
Gene length (bp)6404
Transcript length (bp)4803
Coding sequence length (bp)4803
Protein length (aa) 1601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18404 Glyco_transf_24 Glucosyltransferase 24 4.7E-142 1264 1529
PF18402 Thioredoxin_14 Thioredoxin-like domain 8.7E-55 436 703
PF18400 Thioredoxin_12 Thioredoxin-like domain 2.1E-51 35 232
PF06427 UDP-g_GGTase UDP-glucose:Glycoprotein Glucosyltransferase 1.0E-39 1116 1226
PF18401 Thioredoxin_13 Thioredoxin-like domain 2.6E-35 301 427
PF18403 Thioredoxin_15 Thioredoxin-like domain 3.1E-33 738 938
PF01501 Glyco_transf_8 Glycosyl transferase family 8 1.3E-05 1275 1389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09140|UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt1 PE=1 SV=2 20 1528 0.0E+00
sp|Q09332|UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster GN=Ugt PE=1 SV=2 2 1570 0.0E+00
sp|Q9NYU1|UGGG2_HUMAN UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens GN=UGGT2 PE=1 SV=4 19 1548 0.0E+00
sp|Q6P5E4|UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus GN=Uggt1 PE=1 SV=4 1 1540 0.0E+00
sp|Q0WL80|UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana GN=UGGT PE=1 SV=1 24 1537 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09140|UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt1 PE=1 SV=2 20 1528 0.0E+00
sp|Q09332|UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster GN=Ugt PE=1 SV=2 2 1570 0.0E+00
sp|Q9NYU1|UGGG2_HUMAN UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens GN=UGGT2 PE=1 SV=4 19 1548 0.0E+00
sp|Q6P5E4|UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus GN=Uggt1 PE=1 SV=4 1 1540 0.0E+00
sp|Q0WL80|UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana GN=UGGT PE=1 SV=1 24 1537 0.0E+00
sp|Q9JLA3|UGGG1_RAT UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus GN=Uggt1 PE=1 SV=2 17 1540 0.0E+00
sp|Q9NYU2|UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens GN=UGGT1 PE=1 SV=3 2 1537 0.0E+00
sp|Q8T191|UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum GN=ggtA PE=1 SV=2 744 1530 2.0E-144
sp|P22023|KRE5_YEAST Killer toxin-resistance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE5 PE=1 SV=2 1036 1473 6.0E-22
sp|Q8T191|UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum GN=ggtA PE=1 SV=2 5 502 1.0E-12
sp|P22023|KRE5_YEAST Killer toxin-resistance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE5 PE=1 SV=2 298 542 4.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0016757 glycosyltransferase activity Yes
GO:0003980 UDP-glucose:glycoprotein glucosyltransferase activity Yes
GO:0043413 macromolecule glycosylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0070085 glycosylation No
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0008194 UDP-glycosyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0036211 protein modification process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|112330
MAWALAVLGACLALQHANAGSPPVRVSLTPSWPDPPVVAEVLESVALVNPDGFFQLLDQVTDPDASIFAQSSTPQ
SLYQSGISSAVTHGVIQGAGDLAEVHMNLYLHAATPKLEAFYQHYDDRHKDSTGTVCGSWVDWYGQVVCDLESLV
QLVERQVSEETNAEPPKILTFDHIHPSHSTTIDRPHRTAILYATLDSENFRGLHSYLYSEANKPEPRIQYVLRHV
PPQGPRSKLNYLSGYGVSLDLKKMDYLAIDDRYSSEKQSTQGDSQVDDKDSSRNMDDVFSLIQAHPENETLIDAK
ATLTEEEFNTIGYKAVQLIAESTNSLQTVTTLSQNFPKYATSLSRRVQVNSSIEEELGKKARKIAPGANYFWFNG
QTVAPRDVHVFGLMNLLKKEKSLMKQLIGLGLERSEALEVMTHAEVTSAQKDGLVTDGLLDASDRPEKGDVIVWF
NDIENDPKYMRGNPSVRGVLQAYPGSMPNVRRNLFNIILVLDLRQSSNIQLIGTLVYNVVSKGLPYRFGLVPLIE
NEDSLKMAKVISYMLKNFGWKITTNLCQSIANPTTIYEDHPEKVPEYVSLETVKGTYIALMSNEMDKSQFLPFDD
LVGDKKFARPAFTIPTDKITRYVERLGAGTKQSASGRGHVFFNGKPLPLNAVLADALQAEAGQQLQYLQEKVYLN
IVTDETHPDISTYFYDLPTTQKRRNQYIVPSTSKVKVVSVPEVLTKSGLDGVLEGGSWMYPKSDRKPVIVSLFVV
ADFDSEEGKETLKQALEFLAQTSESRVTFLHNPSATPNDSTRTSISSTLAHLISTHTLSKVSSQKLSEALDLSMT
IATGESDKQAPLDIVDIEDKFDSDSYGRYVKASRLAARALGIKGGETGIVINGRVIAPLGKDQFSTADFVSVVNF
ENKRRAVAVADALRSVKNGVDELDGTSYANLVSMLTSTIGASQQPDPSEVGLFDTPPRPRSRNYQILDSEYTAIK
IGNNETALYHVAVVMDPLSLLAQKWSSLLQWLSTVPDVFVEIHMNPGRYTEMPLKRFYRYNVIPHATLSFDEATG
NEIPSEVVFDDLPIDPIYTLAMDVPPSWLVRPRVALYDLDNILLTQLSPEDKSVDATFSLDYLVVEGHARDTKTL
EPPRGVQLELVKTSDKTPIDDTLVVANLGYLQFKAKPGVFQLQIREGRGRKIFEMESVGNEGWNSPSVKEAGDEI
VLDSFDGLTLYPRLERLPGMEWEDVLDEEENSEASVMGSFTNKFMSMFGKEEKGMTAVEEQADINIFTVASGLLY
ERFASIMILSVLRNTKSSVKFWFIENFLSPSFLEFIPHMAEKYGFKYELVTYKWPSWLRAQSEKQRIIWAYKILF
LDVLFPMDLKKVVFVDADQIVRADLQELVDLDLQGAPYAFTPMGDDNTAMEGFRFWKTGYWKDFLQGLPYHISAL
YVIDLWKFRQMTAGDILRGQYQALSMDPNSLSNLDQDLPNNLQRQVPIFSLHEDWLWCETWCSKDRLDRAKTIDL
CQNPLTKEPKLSRARQIPEWEEYDSEIAHFARELAKEGKIRSRFATADADVLASASAALVTDEILPVMGEPDYME
EYEDTDAPEEPSAAEESKISGRDEL*
Coding >Agabi119p4|112330
ATGGCTTGGGCTCTTGCAGTCCTCGGCGCATGTCTCGCTCTCCAGCACGCAAATGCTGGCAGCCCACCGGTCAGA
GTTTCTCTTACTCCCTCCTGGCCCGATCCCCCCGTGGTCGCCGAAGTTCTCGAATCCGTAGCGCTTGTTAATCCC
GACGGCTTCTTTCAACTTCTCGACCAGGTTACAGATCCAGACGCGTCCATATTCGCGCAGTCTTCTACCCCACAG
TCCCTCTATCAGTCCGGTATCTCCTCTGCCGTCACGCATGGAGTTATCCAGGGGGCTGGTGATCTAGCCGAGGTC
CACATGAACCTCTATTTGCATGCTGCCACACCCAAGCTGGAAGCATTTTATCAGCATTATGACGACAGGCATAAG
GATAGCACCGGTACCGTGTGTGGATCCTGGGTCGACTGGTATGGACAAGTCGTATGTGATCTCGAGTCGCTCGTA
CAGTTAGTTGAGCGACAAGTATCAGAAGAGACAAATGCGGAACCACCAAAGATTCTTACATTCGACCACATACAT
CCCTCGCACAGTACGACTATTGACCGACCCCACCGAACCGCTATCCTCTATGCCACCTTGGATTCTGAGAACTTC
CGAGGCTTGCATTCATACCTCTACTCGGAAGCGAATAAACCCGAACCCCGTATTCAATATGTCCTGCGTCATGTA
CCACCTCAAGGACCTCGGTCGAAACTCAACTATCTTTCTGGATACGGTGTTTCACTAGACCTGAAGAAGATGGAC
TACTTGGCTATTGATGATAGATATTCATCAGAAAAACAATCGACACAAGGAGATAGTCAAGTAGATGATAAAGAC
TCCAGTCGTAACATGGACGACGTCTTCTCCCTTATACAGGCTCACCCAGAAAATGAAACGCTAATTGACGCAAAA
GCAACCCTCACCGAGGAAGAGTTCAACACTATCGGCTACAAAGCAGTCCAACTAATCGCTGAATCGACAAATTCA
TTACAAACTGTGACTACTCTCTCGCAAAACTTTCCCAAATACGCAACGTCTCTCTCCCGTCGTGTTCAAGTCAAC
TCGAGCATCGAAGAAGAGCTGGGCAAGAAAGCGCGCAAGATTGCACCTGGAGCCAATTACTTTTGGTTTAATGGT
CAAACTGTTGCTCCCCGCGACGTCCATGTTTTTGGCCTTATGAATTTATTGAAGAAGGAAAAGAGTTTGATGAAA
CAACTCATTGGGTTAGGGTTAGAGAGAAGTGAGGCTCTGGAAGTAATGACACATGCCGAAGTTACTAGCGCTCAG
AAGGATGGGCTTGTTACCGATGGATTATTGGATGCAAGCGACAGACCTGAGAAGGGCGACGTCATTGTCTGGTTC
AATGACATTGAGAATGATCCCAAGTATATGCGGGGGAATCCATCAGTCCGCGGGGTACTTCAAGCGTATCCAGGA
TCAATGCCGAATGTCAGACGCAATTTGTTCAATATCATCCTCGTTCTAGATCTCCGTCAATCGAGCAACATACAG
TTGATTGGTACCCTGGTTTACAACGTCGTCAGTAAAGGTTTACCATACCGATTTGGTCTCGTACCACTTATCGAG
AATGAGGACAGTCTGAAGATGGCGAAAGTGATTTCTTATATGCTTAAAAATTTTGGCTGGAAGATTACTACGAAC
TTATGTCAATCGATTGCCAACCCAACGACCATATACGAAGATCACCCTGAAAAGGTCCCTGAATACGTCTCCCTG
GAGACCGTCAAAGGTACATACATCGCACTCATGAGCAACGAAATGGACAAATCCCAGTTTCTTCCGTTCGACGAC
CTCGTTGGCGATAAGAAATTTGCGCGTCCCGCTTTTACTATACCTACCGACAAGATCACGCGTTATGTCGAGAGA
TTGGGTGCTGGCACAAAGCAGTCGGCGAGTGGACGAGGGCATGTTTTCTTCAATGGTAAACCACTCCCTCTGAAT
GCGGTACTTGCAGATGCATTACAGGCCGAGGCCGGACAACAATTGCAATATCTACAAGAAAAGGTTTACCTGAAC
ATTGTTACGGATGAAACTCACCCCGATATATCTACATACTTTTACGATTTGCCTACAACGCAAAAACGTCGAAAT
CAGTATATCGTGCCTTCGACCAGTAAAGTCAAAGTAGTCAGTGTGCCTGAGGTTTTGACCAAGTCGGGTCTGGAT
GGTGTACTCGAGGGAGGATCATGGATGTATCCTAAATCCGATAGGAAACCGGTTATAGTGAGCTTGTTTGTCGTT
GCAGATTTCGATTCGGAGGAAGGAAAAGAGACTTTGAAGCAGGCGTTGGAGTTTCTCGCGCAGACTTCTGAGTCG
CGTGTTACGTTCCTTCATAATCCCTCTGCGACACCTAACGATTCAACAAGAACCTCAATATCATCCACTCTCGCA
CATCTAATCTCCACGCACACTTTGTCCAAAGTGTCATCTCAAAAACTCTCTGAGGCTCTAGACCTCTCGATGACC
ATAGCGACGGGAGAGTCGGATAAACAAGCTCCTCTTGATATCGTTGATATTGAGGACAAATTCGATTCGGACTCG
TATGGTCGGTATGTCAAAGCTTCGAGGTTGGCTGCTAGGGCGTTAGGTATCAAAGGTGGTGAAACTGGTATTGTT
ATCAATGGACGCGTCATCGCACCGTTGGGGAAGGATCAGTTCTCGACTGCTGATTTTGTCAGCGTAGTAAATTTC
GAGAATAAGAGACGGGCTGTAGCTGTTGCCGATGCTTTGAGAAGTGTCAAAAATGGTGTTGATGAACTTGACGGG
ACTTCCTATGCGAATCTAGTGTCGATGTTGACTTCAACTATTGGTGCTAGTCAACAACCTGATCCAAGTGAAGTG
GGTTTGTTTGATACGCCGCCGAGACCGAGAAGTAGGAATTATCAGATTCTGGATTCGGAATATACCGCCATAAAG
ATTGGAAATAATGAGACGGCGTTGTATCATGTCGCTGTTGTAATGGATCCTCTAAGCTTGTTGGCGCAGAAGTGG
TCGTCTTTGCTGCAGTGGTTGAGTACGGTTCCTGATGTGTTTGTTGAAATTCATATGAACCCAGGGCGGTACACT
GAAATGCCATTGAAACGTTTCTATCGATACAATGTCATTCCTCATGCTACTCTCTCCTTTGATGAGGCTACTGGC
AACGAAATCCCTTCCGAAGTCGTTTTCGATGATCTTCCCATAGATCCTATCTATACCCTTGCTATGGACGTTCCA
CCTTCTTGGCTTGTCCGTCCCCGTGTAGCGCTCTATGATCTCGATAATATCCTTCTCACTCAACTTTCCCCGGAG
GACAAGAGCGTAGATGCTACTTTCTCTTTGGATTACCTTGTCGTTGAAGGTCATGCCCGCGACACTAAAACACTC
GAGCCTCCGCGTGGTGTTCAACTTGAACTCGTCAAAACAAGTGACAAGACTCCTATAGATGACACTCTCGTCGTA
GCAAACCTTGGCTATCTACAGTTTAAAGCGAAACCTGGAGTGTTCCAATTGCAAATTCGTGAAGGTAGAGGAAGA
AAGATTTTTGAGATGGAGAGTGTGGGCAATGAGGGGTGGAATAGTCCTAGTGTTAAGGAGGCTGGAGATGAGATT
GTTTTGGACAGTTTTGATGGGTTGACTTTGTATCCGAGGTTGGAGAGGTTGCCTGGGATGGAGTGGGAGGATGTG
CTTGATGAAGAGGAAAATTCTGAAGCTTCGGTGATGGGAAGTTTCACGAACAAATTTATGTCGATGTTTGGGAAG
GAAGAGAAAGGTATGACGGCGGTGGAGGAGCAAGCGGATATCAACATTTTCACTGTTGCTTCGGGTTTGCTTTAC
GAGCGATTTGCGTCGATCATGATTCTGAGTGTCCTTCGTAATACTAAGAGTTCTGTCAAGTTTTGGTTCATTGAA
AACTTCCTGTCTCCTTCCTTCCTCGAATTCATTCCGCATATGGCTGAGAAATACGGGTTCAAATACGAACTTGTA
ACCTACAAGTGGCCGTCTTGGCTTCGCGCTCAGTCTGAGAAGCAACGTATCATTTGGGCATACAAGATCCTCTTC
TTAGATGTTCTTTTCCCGATGGACCTCAAGAAAGTCGTTTTCGTTGATGCTGACCAGATTGTTCGTGCGGATCTT
CAAGAACTTGTAGACCTTGATCTTCAGGGAGCGCCTTATGCTTTCACGCCTATGGGTGACGATAATACCGCCATG
GAAGGATTCAGGTTTTGGAAGACGGGGTATTGGAAGGATTTCCTTCAGGGATTACCTTACCATATTAGTGCCTTG
TACGTGATTGATCTTTGGAAGTTTAGACAGATGACAGCAGGTGATATTCTCCGCGGTCAATACCAAGCTTTGTCC
ATGGACCCCAATTCTTTGTCGAACCTCGATCAAGACTTACCAAATAACCTTCAACGACAAGTGCCTATCTTCTCA
CTTCACGAAGACTGGCTCTGGTGTGAAACTTGGTGTAGCAAGGATCGACTGGATCGGGCAAAGACTATTGACTTA
TGTCAGAATCCTCTTACAAAAGAACCCAAGTTATCGCGTGCTCGTCAAATACCCGAGTGGGAAGAATATGACTCT
GAAATAGCTCACTTCGCTAGGGAGTTGGCGAAAGAGGGAAAAATACGTTCGCGTTTTGCGACCGCTGATGCGGAT
GTTCTTGCCAGTGCGAGTGCGGCGCTGGTAACAGATGAAATACTTCCAGTGATGGGTGAGCCAGATTATATGGAA
GAATATGAGGATACAGACGCTCCCGAGGAACCGTCTGCTGCAGAGGAGAGTAAGATATCAGGTCGGGATGAGTTG
TAA
Transcript >Agabi119p4|112330
ATGGCTTGGGCTCTTGCAGTCCTCGGCGCATGTCTCGCTCTCCAGCACGCAAATGCTGGCAGCCCACCGGTCAGA
GTTTCTCTTACTCCCTCCTGGCCCGATCCCCCCGTGGTCGCCGAAGTTCTCGAATCCGTAGCGCTTGTTAATCCC
GACGGCTTCTTTCAACTTCTCGACCAGGTTACAGATCCAGACGCGTCCATATTCGCGCAGTCTTCTACCCCACAG
TCCCTCTATCAGTCCGGTATCTCCTCTGCCGTCACGCATGGAGTTATCCAGGGGGCTGGTGATCTAGCCGAGGTC
CACATGAACCTCTATTTGCATGCTGCCACACCCAAGCTGGAAGCATTTTATCAGCATTATGACGACAGGCATAAG
GATAGCACCGGTACCGTGTGTGGATCCTGGGTCGACTGGTATGGACAAGTCGTATGTGATCTCGAGTCGCTCGTA
CAGTTAGTTGAGCGACAAGTATCAGAAGAGACAAATGCGGAACCACCAAAGATTCTTACATTCGACCACATACAT
CCCTCGCACAGTACGACTATTGACCGACCCCACCGAACCGCTATCCTCTATGCCACCTTGGATTCTGAGAACTTC
CGAGGCTTGCATTCATACCTCTACTCGGAAGCGAATAAACCCGAACCCCGTATTCAATATGTCCTGCGTCATGTA
CCACCTCAAGGACCTCGGTCGAAACTCAACTATCTTTCTGGATACGGTGTTTCACTAGACCTGAAGAAGATGGAC
TACTTGGCTATTGATGATAGATATTCATCAGAAAAACAATCGACACAAGGAGATAGTCAAGTAGATGATAAAGAC
TCCAGTCGTAACATGGACGACGTCTTCTCCCTTATACAGGCTCACCCAGAAAATGAAACGCTAATTGACGCAAAA
GCAACCCTCACCGAGGAAGAGTTCAACACTATCGGCTACAAAGCAGTCCAACTAATCGCTGAATCGACAAATTCA
TTACAAACTGTGACTACTCTCTCGCAAAACTTTCCCAAATACGCAACGTCTCTCTCCCGTCGTGTTCAAGTCAAC
TCGAGCATCGAAGAAGAGCTGGGCAAGAAAGCGCGCAAGATTGCACCTGGAGCCAATTACTTTTGGTTTAATGGT
CAAACTGTTGCTCCCCGCGACGTCCATGTTTTTGGCCTTATGAATTTATTGAAGAAGGAAAAGAGTTTGATGAAA
CAACTCATTGGGTTAGGGTTAGAGAGAAGTGAGGCTCTGGAAGTAATGACACATGCCGAAGTTACTAGCGCTCAG
AAGGATGGGCTTGTTACCGATGGATTATTGGATGCAAGCGACAGACCTGAGAAGGGCGACGTCATTGTCTGGTTC
AATGACATTGAGAATGATCCCAAGTATATGCGGGGGAATCCATCAGTCCGCGGGGTACTTCAAGCGTATCCAGGA
TCAATGCCGAATGTCAGACGCAATTTGTTCAATATCATCCTCGTTCTAGATCTCCGTCAATCGAGCAACATACAG
TTGATTGGTACCCTGGTTTACAACGTCGTCAGTAAAGGTTTACCATACCGATTTGGTCTCGTACCACTTATCGAG
AATGAGGACAGTCTGAAGATGGCGAAAGTGATTTCTTATATGCTTAAAAATTTTGGCTGGAAGATTACTACGAAC
TTATGTCAATCGATTGCCAACCCAACGACCATATACGAAGATCACCCTGAAAAGGTCCCTGAATACGTCTCCCTG
GAGACCGTCAAAGGTACATACATCGCACTCATGAGCAACGAAATGGACAAATCCCAGTTTCTTCCGTTCGACGAC
CTCGTTGGCGATAAGAAATTTGCGCGTCCCGCTTTTACTATACCTACCGACAAGATCACGCGTTATGTCGAGAGA
TTGGGTGCTGGCACAAAGCAGTCGGCGAGTGGACGAGGGCATGTTTTCTTCAATGGTAAACCACTCCCTCTGAAT
GCGGTACTTGCAGATGCATTACAGGCCGAGGCCGGACAACAATTGCAATATCTACAAGAAAAGGTTTACCTGAAC
ATTGTTACGGATGAAACTCACCCCGATATATCTACATACTTTTACGATTTGCCTACAACGCAAAAACGTCGAAAT
CAGTATATCGTGCCTTCGACCAGTAAAGTCAAAGTAGTCAGTGTGCCTGAGGTTTTGACCAAGTCGGGTCTGGAT
GGTGTACTCGAGGGAGGATCATGGATGTATCCTAAATCCGATAGGAAACCGGTTATAGTGAGCTTGTTTGTCGTT
GCAGATTTCGATTCGGAGGAAGGAAAAGAGACTTTGAAGCAGGCGTTGGAGTTTCTCGCGCAGACTTCTGAGTCG
CGTGTTACGTTCCTTCATAATCCCTCTGCGACACCTAACGATTCAACAAGAACCTCAATATCATCCACTCTCGCA
CATCTAATCTCCACGCACACTTTGTCCAAAGTGTCATCTCAAAAACTCTCTGAGGCTCTAGACCTCTCGATGACC
ATAGCGACGGGAGAGTCGGATAAACAAGCTCCTCTTGATATCGTTGATATTGAGGACAAATTCGATTCGGACTCG
TATGGTCGGTATGTCAAAGCTTCGAGGTTGGCTGCTAGGGCGTTAGGTATCAAAGGTGGTGAAACTGGTATTGTT
ATCAATGGACGCGTCATCGCACCGTTGGGGAAGGATCAGTTCTCGACTGCTGATTTTGTCAGCGTAGTAAATTTC
GAGAATAAGAGACGGGCTGTAGCTGTTGCCGATGCTTTGAGAAGTGTCAAAAATGGTGTTGATGAACTTGACGGG
ACTTCCTATGCGAATCTAGTGTCGATGTTGACTTCAACTATTGGTGCTAGTCAACAACCTGATCCAAGTGAAGTG
GGTTTGTTTGATACGCCGCCGAGACCGAGAAGTAGGAATTATCAGATTCTGGATTCGGAATATACCGCCATAAAG
ATTGGAAATAATGAGACGGCGTTGTATCATGTCGCTGTTGTAATGGATCCTCTAAGCTTGTTGGCGCAGAAGTGG
TCGTCTTTGCTGCAGTGGTTGAGTACGGTTCCTGATGTGTTTGTTGAAATTCATATGAACCCAGGGCGGTACACT
GAAATGCCATTGAAACGTTTCTATCGATACAATGTCATTCCTCATGCTACTCTCTCCTTTGATGAGGCTACTGGC
AACGAAATCCCTTCCGAAGTCGTTTTCGATGATCTTCCCATAGATCCTATCTATACCCTTGCTATGGACGTTCCA
CCTTCTTGGCTTGTCCGTCCCCGTGTAGCGCTCTATGATCTCGATAATATCCTTCTCACTCAACTTTCCCCGGAG
GACAAGAGCGTAGATGCTACTTTCTCTTTGGATTACCTTGTCGTTGAAGGTCATGCCCGCGACACTAAAACACTC
GAGCCTCCGCGTGGTGTTCAACTTGAACTCGTCAAAACAAGTGACAAGACTCCTATAGATGACACTCTCGTCGTA
GCAAACCTTGGCTATCTACAGTTTAAAGCGAAACCTGGAGTGTTCCAATTGCAAATTCGTGAAGGTAGAGGAAGA
AAGATTTTTGAGATGGAGAGTGTGGGCAATGAGGGGTGGAATAGTCCTAGTGTTAAGGAGGCTGGAGATGAGATT
GTTTTGGACAGTTTTGATGGGTTGACTTTGTATCCGAGGTTGGAGAGGTTGCCTGGGATGGAGTGGGAGGATGTG
CTTGATGAAGAGGAAAATTCTGAAGCTTCGGTGATGGGAAGTTTCACGAACAAATTTATGTCGATGTTTGGGAAG
GAAGAGAAAGGTATGACGGCGGTGGAGGAGCAAGCGGATATCAACATTTTCACTGTTGCTTCGGGTTTGCTTTAC
GAGCGATTTGCGTCGATCATGATTCTGAGTGTCCTTCGTAATACTAAGAGTTCTGTCAAGTTTTGGTTCATTGAA
AACTTCCTGTCTCCTTCCTTCCTCGAATTCATTCCGCATATGGCTGAGAAATACGGGTTCAAATACGAACTTGTA
ACCTACAAGTGGCCGTCTTGGCTTCGCGCTCAGTCTGAGAAGCAACGTATCATTTGGGCATACAAGATCCTCTTC
TTAGATGTTCTTTTCCCGATGGACCTCAAGAAAGTCGTTTTCGTTGATGCTGACCAGATTGTTCGTGCGGATCTT
CAAGAACTTGTAGACCTTGATCTTCAGGGAGCGCCTTATGCTTTCACGCCTATGGGTGACGATAATACCGCCATG
GAAGGATTCAGGTTTTGGAAGACGGGGTATTGGAAGGATTTCCTTCAGGGATTACCTTACCATATTAGTGCCTTG
TACGTGATTGATCTTTGGAAGTTTAGACAGATGACAGCAGGTGATATTCTCCGCGGTCAATACCAAGCTTTGTCC
ATGGACCCCAATTCTTTGTCGAACCTCGATCAAGACTTACCAAATAACCTTCAACGACAAGTGCCTATCTTCTCA
CTTCACGAAGACTGGCTCTGGTGTGAAACTTGGTGTAGCAAGGATCGACTGGATCGGGCAAAGACTATTGACTTA
TGTCAGAATCCTCTTACAAAAGAACCCAAGTTATCGCGTGCTCGTCAAATACCCGAGTGGGAAGAATATGACTCT
GAAATAGCTCACTTCGCTAGGGAGTTGGCGAAAGAGGGAAAAATACGTTCGCGTTTTGCGACCGCTGATGCGGAT
GTTCTTGCCAGTGCGAGTGCGGCGCTGGTAACAGATGAAATACTTCCAGTGATGGGTGAGCCAGATTATATGGAA
GAATATGAGGATACAGACGCTCCCGAGGAACCGTCTGCTGCAGAGGAGAGTAAGATATCAGGTCGGGATGAGTTG
TAA
Gene >Agabi119p4|112330
ATGGCTTGGGCTCTTGCAGTCCTCGGCGCATGTCTCGCTCTCCAGCACGCAAATGCTGGCAGCCCACCGGTCAGA
GTTTCTCTTACTCCCTCCTGGCCCGATCCCCCCGTGGTCGCCGAAGTTCTGTGAGTCGCTCTATACATATCATTA
CACTTGTTCTGATGTCACTTTAGCGAATCCGTAGCGCTTGTTAATCCCGACGGCTTCTTTCAACTTCTCGACCAG
GTTACAGATCCAGACGCGTCCATATTCGCGCAGTCTTCTACCCCACAGTCCCTCTATCAGTCCGGTATCTCCTCT
GCCGTCACGCATGGAGTTATCCAGGGGGCTGGTGATCTAGCCGAGGTCCACATGAACCTCTATTTGCATGCTGCC
ACACCCAAGCTGGAAGCATTTTATCAGCATTATGACGACAGGCATAAGGATAGCACCGGTACCGTGTGTGGATCC
TGGGTCGACTGGTATGGACAAGTCGTATGTGATCTCGAGTCGCTCGTACAGTTAGTTGAGCGACAAGTATCAGAA
GAGACAAATGCGGAACCGTAAGCATGCATCTCATCTTTCGCTTAGATTTGACTTAAGCTCTACCCTAGACCAAAG
ATTCTTACATTCGACCACATACATCCCTCGCACAGTACGACTATTGACCGACCCCACCGAACCGCTATCCTCTAT
GCCACCTTGGATTCTGAGAACTTCCGAGGCTTGCATTCATACCTCTACTCGGAAGCGAATAAACCCGAACCCCGT
ATTCAATATGTCCTGCGTCATGTACCACCTCAAGGACCTCGGTCGAAACTCAACTATCTTTCTGGATACGGTGTT
TCACTAGACCTGAAGAAGATGGACTACTTGGCTATTGATGATAGATATTCATCAGAAAAACGTACGTGCTTCGAG
TCCCATTCTATCACCCAATCCTTACTTTTACGCAGAATCGACACAAGGAGATAGTCAAGTAGATGATAAAGACTC
CAGTCGTAACATGGACGACGTCTTCTCCCTTATACAGGCTCACCCAGAAAATGAAACGCTAATTGACGCAAAAGC
AACCCTCACCGAGGAAGAGTTCAACAGTGCGTTGTGTCAATATCATATCAATCATCTACTGACCCCATTTCACAG
CTATCGGCTACAAAGCAGTCCAACTAATCGCTGAATCGACAAATTCATTACAAACTGTGACTACTCTCTCGCAAA
ACTTTCCCAAATACGCAACGTCTCTCTCCCGTCGTGTTCAAGTCAACTCGAGCATCGAAGAAGAGCTGGGCAAGA
AAGCGCGCAAGATTGCACCTGGAGCCAATTACTTTTGGTTTAATGGTCAAACTGTTGCTCCCCGCGACGTCCATG
TTTTTGGCCTTATGAATTTATTGAAGAAGGAAAAGAGTTTGATGAAACAACTCATTGGGTTAGGGTTAGAGAGAA
GTGAGGCTCTGGAAGTAATGACACATGCCGAAGTTACTAGCGCTCAGAAGGATGGGCTTGTTACCGATGGATTAT
TGGATGCAAGCGACAGACCTGAGAAGGGCGACGTCATTGTCTGGTTCAATGACATTGAGAATGATCCCAAGTGAG
TAGTATCCAATGAGCCATTTCTATTGAAGCTGATTTCAATTGGTGAAGGTATATGCGGGGGAATCCATCAGTCCG
CGGGGTATGTCCAGTAATTCCATTTTTGCATTGTTCGGGAGCTGATACGGTTGACCAGGTACTTCAAGCGTATCC
AGGATCAATGCCGAATGTCAGACGCAATTTGTTCAATATCATCCTCGTTCTAGATCTCCGTCAATCGAGCAACAT
ACAGTTGATTGGTACCCTGGTTTACAACGTCGTCAGTAAAGGTTTACCATACCGATTTGGTCTCGTACCACTTAT
CGAGAATGAGGACAGTAAGTTCAATTTTCATGCTTGCCAATGCTTCATATTTGACTGGTGTTGATAGGTCTGAAG
ATGGCGAAAGTGATTTCTTATATGCTTAAAAATTTTGGCTGGAAGATTACTACGAACTTATGTCAATCGGTTGGT
TGTTCATTATTTCCGTCGATGACTAGTGCTCACATCCTCTAGATTGCCAACCCAACGACCATATACGAAGATCAC
CCTGAAAAGGTCCCTGAATACGTCTCCCTGGAGACCGTCAAAGGTACATACATCGCACTCATGAGCAACGAAATG
GACAAATCCCAGTTTCTTCCGTTCGACGACCTCGTTGGCGATAAGAAATTTGCGCGTCCCGCTTTTACTATACCT
ACCGACAAGATCACGCGTTATGTCGAGAGATTGGGTGCTGGCACAAAGCAGTCGGCGAGTGGACGAGGGCATGTT
TTCTTCAATGGTAAACCACTCCCTCTGAATGCGGTAAGTGTGTCTCTTCTTTATTTTTGTATGATGAGCTCAAAA
CATTTGTTAGGTACTTGCAGATGCATTACAGGCCGAGGCCGGACAACAATTGCAATATCTACAAGAAAAGGTATT
CATCTATCTTTCTCTCTTTACCGTTTTGTCTTAAACATGATATCCGTCAGGTTTACCTGAACATTGTTACGGATG
AAACTCACCCCGATATATCTACATACTTTTACGATTTGCCTACAACGCAAAAACGTCGAAATCAGTATATCGTGC
CTTCGACCAGTAAAGTCAAAGTAGTCAGTGTGCCTGAGGTTTTGACCAAGTCGGGTCTGGATGGTGTACTCGAGG
GAGGATCATGGATGTATCCTAGTAAGTCGTTTTACGTGTCACGATTTGAAGGATGGGTGTGCTTATATGCATATA
AGAATCCGATAGGAAACCGGTTATAGTGAGCTTGTTTGTCGTTGCAGATTTCGATTCGGAGGAAGGAAAAGAGAC
TTTGAAGCAGGCGTTGGAGTTTCTCGTACGTTTTGGTTTTGTGGTTTGGGTCATTTTATACGTACTGATTGGATT
TTGTTCTAGGCGCAGACTTCTGAGTCGCGTGTTACGTTCCTTCATAATCCCTCTGCGACACCTAACGATTCAACA
AGAACCTCAATATCATCCACTCTCGCACATCTAATCTCCACGCACACTTTGTCCAAAGTGTCATCTCAAAAACTC
TCTGAGGCTCTAGACCTCTCGATGACCATAGCGACGGGAGAGTCGGATAAACAAGCTCCTCTTGATATCGTTGAT
ATTGAGGACAAATTCGATTCGGACTCGTATGGTCGGTATGTCAAAGCTTCGAGGTTGGCTGCTAGGGCGTTAGGT
ATCAAAGGTGGTGAAACTGGTATTGTTATCAATGGACGCGTAAGCCTTCAAAGTTTACTTTTGTATCGCATTATG
ATGCTGAGAAATATGCGGCAGGTCATCGCACCGTTGGGGAAGGATCAGTTCTCGACTGCTGATTTTGTCAGCGTA
GTAAATTTCGAGAATAAGAGACGGGCTGTAGCTGTTGCCGATGCTTTGAGAAGTGTCAAAAATGGTGTTGATGAA
CTTGACGGGTATATAAACCCTTTCTACACGATGTTGTCGATGCTAAATGCTGAGGTTTACAGGACTTCCTATGCG
AATCTAGTGTCGATGTTGACTTCAACTATTGGTGCTAGTCAACAACCTGATCCAAGTGAAGTGGGTTTGTTTGAT
ACGCCGCCGAGACCGAGAAGTAGGAATTATCAGATTCTGGATTCGGAATATACGTAAGTCTGATGTTTGGAAGCA
TTTTTTTCTCGTTCGTTTTGAGTTTGCTCATCCGCTCGTTCTTTTTTTTTTTCATATGAAGCGCCATAAAGATTG
GAAATAATGAGACGGCGTTGTATCATGTCGCTGTTGTAATGGATCCTCTAAGCTTGTTGGCGCAGAAGTGGTCGT
CTTTGCTGCAGGTGAGTTGTTGTTGCCTTTGCGTATCATATGGGTTTTGAAAATAATATTGTGTCACAGTGGTTG
AGTACGGTTCCTGATGTGTTTGTTGAAATTCATATGAACCCAGGGCGGTACACTGAAGTGAGTGTTTCCAATTGA
CTCTGTAGCAAGACGTTGACCAAATCATGCCCGTGTAGATGCCATTGAAACGTTTCTATCGATACAATGTCATTC
CTCATGCTACTCTCTCCTTTGATGAGGCTACTGGGTGAGTTTCTCCTACAGCTTCTGTGACTTTTCAGTTATCCT
TAATGGTATAACAGCAACGAAATCCCTTCCGAAGTCGTTTTCGATGATCTTCCCATAGATCCTATCTATACCCTT
GCTATGGACGTTCCACCTTCTTGGCTTGTCCGTCCCCGTGTAGCGCTCTATGATCTCGATAATATCCTTCTCACT
CAACTTTCCCCGGAGGACAAGAGCGTAGATGCTACTTTCTCTTTGGATTACCTTGTCGTTGAAGGTCATGCCCGC
GACACTAAAACACTCGAGCCTCCGCGTGGTGTTCAACTTGAACTCGTCAAAACAAGTGACAAGACTCCTATAGAT
GACACTCTCGTCGTAGCAAACCTTGGCTATCTACAGTTTAAAGCGAAACCTGGAGTGTTCCAATTGCAAATTCGT
GAAGGTAGAGGAAGAAAGATTTTTGAGATGGAGAGTGTGGGCAATGAGGGGTGGAATAGTCCTAGTGTTAAGGAG
GCTGGAGATGAGATTGTTTTGGACAGTTTTGATGGGTTGACTTTGTATCCGAGGTTGGAGAGGTTGCCTGGGATG
GAGTGGGAGGATGTGCTTGATGAAGAGGAAAATTCTGAAGCTTCGGTGATGGGAAGTTTCACGAACAAATTTATG
TCGATGTTTGGGAAGGAAGAGAAAGGTATGACGGCGGTGGAGGAGCAAGCGGATATCAACATTTTCACTGTTGCT
TCGGGTTTGCTTTACGAGGTACGTCTGATTAGATCTTCTGTGTGGTTTTTTTGTGTTTCTGACATGTTGTCTTGA
CATGTTGTCACTAGCGATTTGCGTCGATCATGATTCTGAGTGTCCTTCGTAATACTAAGAGTTCTGTCAAGTTTT
GGTTCATTGAAAACTTCCTGTCTCCTTCCTTCCTCGTCAGTCCCAACTTTTGTTGAAAACTCTGGTGGATGTCGG
CTGACCCGCTTTATAGGAATTCATTCCGCATATGGCTGAGAAATACGGGTTCAAATACGAACTTGTAACCTACAA
GTGGCCGTCTTGGCTTCGCGCTCAGTCTGAGAAGCAACGTATCATTTGGGCATACAAGATCCTCTTCTTAGATGT
TCTTTTCCCGATGGACCTCAAGAAAGTCGTTTTCGTTGATGCTGACCAGATTGTTCGTGCGGATCTTCAAGAACT
TGTAGACCTTGATCTTCAGGGAGCGCCTTATGCTTTCACGCCTATGGGTGACGATAATACCGCCATGGAAGGATT
CAGGTTTTGGAAGACGGGGTATTGGAAGGATTTCCTTCAGGGATTACCTTACCATATTAGGTGAGTAAAAAAAAC
TATTCGTTTGGTGATCGTGGTTGACTGATGTTTTGAAATGAAGTGCCTTGTACGTGATTGATCTTTGGAAGTTTA
GACAGGTAGGGGATGAGCGTTAGCATGCATTGGGACGTTTTTGAGCTCATTCAATTGGTTCTTTTTAATTTATCA
CATCACAGATGACAGCAGGTGTAAGTTTTGATGCGCTGTTTCCCCTTGATTCAAATTGATGAATGTGTTTTACAG
GATATTCTCCGCGGTCAATACCAAGCTTTGTCCATGGACCCCAATTCTTTGTCGAACCTCGATCAAGGTCAGGCG
TTTTGATATTCTTTGGGGGTTCGGGTATTGAGTTAAAAATCATGATAACATAGACTTACCAAATAACCTTCAACG
ACAAGTGCCTATCGTACGTGATTGTTTCATTGACCCTTTGTATATGTGTATTAATGTTTTCTTCTTTCCAGTTCT
CACTTCACGAAGACTGGCTCTGGGTGCGTAATTACTTATCTGCATGACATATCTTCCTCTCGGCTGACGAAGACT
GTTTCAAGTGTGAAACTTGGTGTAAGTAATATCTATAGTATTGAACGTTGACACTGACATTTATTTCTTGGGTAT
AAAGGTAGCAAGGATCGACTGGATCGGGCAAAGACTATTGACTTATGTCAGAATCCTCTTACAGTTCGTTTGACA
GTTCATTCTTTCACCTGACTTAAAGCTCTGACGTTCGGCATCAGAAAGAACCCAAGTTATCGCGTGCTCGTCAAA
TACCCGAGTGGGAAGAATATGACTCTGAAATAGCTCACTTCGCTAGGGAGTTGGCGAAAGAGGGAAAAATACGTT
CGCGTTTTGCGACCGCTGATGCGGATGTTCTTGCCAGTGCGAGTGCGGCGCTGGTAACAGATGAAATACTTCCAG
TGATGGGTGAGCCAGATTATATGGAAGAATATGAGGATACAGACGCTCCCGAGGAACCGTCTGCTGCAGAGGAGA
GTAAGATATCAGGTCGGGATGAGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail