Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|111810
Gene name
Locationscaffold_08:1396260..1397361
Strand+
Gene length (bp)1101
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain 2.2E-26 74 146
PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain 2.8E-12 78 138

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52435|RPB11_HUMAN DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens GN=POLR2J PE=1 SV=1 53 149 7.0E-26
sp|O08740|RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus GN=Polr2j PE=1 SV=1 53 149 7.0E-26
sp|Q32P79|RPB11_BOVIN DNA-directed RNA polymerase II subunit RPB11 OS=Bos taurus GN=POLR2J PE=3 SV=1 53 149 7.0E-26
sp|Q9VJE4|RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster GN=Rpb11 PE=3 SV=1 49 149 2.0E-25
sp|Q7PVQ9|RPB11_ANOGA DNA-directed RNA polymerase II subunit RPB11 OS=Anopheles gambiae GN=Rpb11 PE=3 SV=2 49 149 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52435|RPB11_HUMAN DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens GN=POLR2J PE=1 SV=1 53 149 7.0E-26
sp|O08740|RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus GN=Polr2j PE=1 SV=1 53 149 7.0E-26
sp|Q32P79|RPB11_BOVIN DNA-directed RNA polymerase II subunit RPB11 OS=Bos taurus GN=POLR2J PE=3 SV=1 53 149 7.0E-26
sp|Q9VJE4|RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster GN=Rpb11 PE=3 SV=1 49 149 2.0E-25
sp|Q7PVQ9|RPB11_ANOGA DNA-directed RNA polymerase II subunit RPB11 OS=Anopheles gambiae GN=Rpb11 PE=3 SV=2 49 149 1.0E-23
sp|Q9XVH6|RPB11_CAEEL Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis elegans GN=rpb-11 PE=3 SV=1 55 145 1.0E-23
sp|Q9H1A7|RPB1C_HUMAN DNA-directed RNA polymerase II subunit RPB11-b2 OS=Homo sapiens GN=POLR2J3 PE=3 SV=1 55 149 1.0E-23
sp|Q60SM4|RPB11_CAEBR Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis briggsae GN=rpb-11 PE=3 SV=1 55 145 3.0E-23
sp|Q9GZM3|RPB1B_HUMAN DNA-directed RNA polymerase II subunit RPB11-b1 OS=Homo sapiens GN=POLR2J2 PE=1 SV=2 55 149 6.0E-23
sp|Q86JJ5|RPB11_DICDI DNA-directed RNA polymerase II subunit rpb11 OS=Dictyostelium discoideum GN=polr2j PE=3 SV=1 52 155 5.0E-22
sp|P38902|RPB11_YEAST DNA-directed RNA polymerase II subunit RPB11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB11 PE=1 SV=1 51 153 7.0E-22
sp|P87123|RPB11_SCHPO DNA-directed RNA polymerase II subunit RPB11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb11 PE=1 SV=1 67 160 1.0E-21
sp|Q38859|NRPBB_ARATH DNA-directed RNA polymerases II, IV and V subunit 11 OS=Arabidopsis thaliana GN=NRPB11 PE=1 SV=1 53 153 7.0E-16
sp|A4YHV0|RPOL_METS5 DNA-directed RNA polymerase subunit L OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpoL PE=3 SV=1 62 139 3.0E-12
sp|Q54ES6|RPC19_DICDI DNA-directed RNA polymerases I and III subunit rpc19 OS=Dictyostelium discoideum GN=rpc19 PE=3 SV=1 52 137 2.0E-11
sp|P28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC19 PE=1 SV=1 73 148 2.0E-11
sp|Q96YA7|RPOL_SULTO DNA-directed RNA polymerase subunit L OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoL PE=3 SV=1 72 147 3.0E-11
sp|Q09177|RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc19 PE=2 SV=1 73 152 5.0E-10
sp|P46217|RPOL_SULAC DNA-directed RNA polymerase subunit L OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoL PE=3 SV=1 72 134 6.0E-10
sp|P34476|RPAC2_CAEEL Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis elegans GN=rpac-19 PE=3 SV=1 71 152 6.0E-10
sp|Q980K0|RPOL_SULSO DNA-directed RNA polymerase subunit L OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoL PE=1 SV=1 72 142 8.0E-10
sp|Q61IX2|RPAC2_CAEBR Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis briggsae GN=rpac-19 PE=3 SV=1 71 149 1.0E-09
sp|Q8IER7|RPB11_PLAF7 Probable DNA-directed RNA polymerase II subunit RPB11 OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0023 PE=3 SV=1 48 156 2.0E-08
sp|C3N7I8|RPOL_SULIY DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpoL PE=3 SV=1 72 134 2.0E-08
sp|C3NFY8|RPOL_SULIN DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpoL PE=3 SV=1 72 134 2.0E-08
sp|C3MXM0|RPOL_SULIM DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpoL PE=3 SV=1 72 134 2.0E-08
sp|C3MRD1|RPOL_SULIL DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpoL PE=3 SV=1 72 134 2.0E-08
sp|C4KIP6|RPOL_SULIK DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpoL PE=3 SV=1 72 134 2.0E-08
sp|C3MZG6|RPOL_SULIA DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain M.16.27) GN=rpoL PE=3 SV=1 72 134 2.0E-08
sp|Q9Y2S0|RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens GN=POLR1D PE=1 SV=1 72 156 5.0E-08
sp|Q1RMG8|RPAC2_BOVIN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Bos taurus GN=POLR1D PE=2 SV=1 72 165 7.0E-08
sp|Q8U4N1|RPOL_PYRFU DNA-directed RNA polymerase subunit L OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpoL PE=3 SV=1 81 138 2.0E-07
sp|Q5JE88|RPOL_THEKO DNA-directed RNA polymerase subunit L OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpoL PE=1 SV=1 81 138 2.0E-07
sp|B6YTH7|RPOL_THEON DNA-directed RNA polymerase subunit L OS=Thermococcus onnurineus (strain NA1) GN=rpoL PE=3 SV=1 81 149 2.0E-07
sp|Q4XS21|RPB11_PLACH Probable DNA-directed RNA polymerase II subunit RPB11 OS=Plasmodium chabaudi GN=PC000833.03.0 PE=3 SV=1 44 163 3.0E-07
sp|P97304|RPAC2_MOUSE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Mus musculus GN=Polr1d PE=1 SV=1 73 156 3.0E-07
sp|Q4YZZ7|RPB11_PLABA Probable DNA-directed RNA polymerase II subunit RPB11 OS=Plasmodium berghei (strain Anka) GN=PB000758.01.0 PE=3 SV=1 44 163 4.0E-07
sp|Q9V2M4|RPOL_PYRAB DNA-directed RNA polymerase subunit L OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpoL PE=3 SV=1 81 138 9.0E-07
sp|P57671|RPOL_PYRHO DNA-directed RNA polymerase subunit L OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpoL PE=3 SV=1 81 139 1.0E-06
sp|B1L7Q7|RPOL_KORCO DNA-directed RNA polymerase subunit L OS=Korarchaeum cryptofilum (strain OPF8) GN=rpoL PE=3 SV=1 62 153 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0009059 macromolecule biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901360 organic cyclic compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0019438 aromatic compound biosynthetic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097747 RNA polymerase activity No
GO:0016779 nucleotidyltransferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0044237 cellular metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0003824 catalytic activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016070 RNA metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0005515 protein binding No
GO:0034654 nucleobase-containing compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|111810
MDSMSTQDNGIETDLEARLSQIKIAFLSRSFPPRRHLDRQSRIKPSNRTVHIYPILDGEKPVEVVEDSKIPNAAT
IKILKQDHTLGNMLRAQLLSMPQILFAGYKVPHPLHPYFLIKIQTDGTITPQELLEQACTKLIGTMSSLETKFKR
EFSYKDVEGTVGGVTGHLDDPYGGTGTSGGAWSTGKDYLDL*
Coding >Agabi119p4|111810
ATGGACAGCATGTCGACGCAGGATAATGGCATAGAGACTGACCTTGAGGCGAGATTGAGCCAAATAAAAATCGCC
TTTCTATCTCGATCCTTTCCTCCTCGTCGACATTTGGATAGGCAAAGTCGAATCAAACCCTCCAATCGTACTGTT
CATATATATCCCATATTAGATGGCGAAAAGCCTGTGGAAGTGGTTGAAGACAGCAAGATTCCTAATGCCGCAACT
ATCAAGATTTTGAAGCAGGATCATACTTTAGGCAACATGCTCCGCGCTCAACTCCTCTCTATGCCTCAAATCCTC
TTCGCAGGTTATAAAGTCCCACATCCTCTCCACCCCTACTTCCTCATCAAGATCCAGACCGACGGAACCATCACA
CCACAAGAACTTCTCGAACAAGCTTGTACAAAGCTCATCGGAACCATGTCATCATTAGAAACGAAATTCAAGCGA
GAGTTTTCTTATAAGGATGTTGAAGGTACTGTTGGTGGTGTTACAGGTCATCTTGATGATCCTTATGGTGGAACG
GGTACAAGTGGAGGTGCTTGGTCTACAGGCAAAGATTATCTGGACCTTTAG
Transcript >Agabi119p4|111810
ATGGACAGCATGTCGACGCAGGATAATGGCATAGAGACTGACCTTGAGGCGAGATTGAGCCAAATAAAAATCGCC
TTTCTATCTCGATCCTTTCCTCCTCGTCGACATTTGGATAGGCAAAGTCGAATCAAACCCTCCAATCGTACTGTT
CATATATATCCCATATTAGATGGCGAAAAGCCTGTGGAAGTGGTTGAAGACAGCAAGATTCCTAATGCCGCAACT
ATCAAGATTTTGAAGCAGGATCATACTTTAGGCAACATGCTCCGCGCTCAACTCCTCTCTATGCCTCAAATCCTC
TTCGCAGGTTATAAAGTCCCACATCCTCTCCACCCCTACTTCCTCATCAAGATCCAGACCGACGGAACCATCACA
CCACAAGAACTTCTCGAACAAGCTTGTACAAAGCTCATCGGAACCATGTCATCATTAGAAACGAAATTCAAGCGA
GAGTTTTCTTATAAGGATGTTGAAGGTACTGTTGGTGGTGTTACAGGTCATCTTGATGATCCTTATGGTGGAACG
GGTACAAGTGGAGGTGCTTGGTCTACAGGCAAAGATTATCTGGACCTTTAG
Gene >Agabi119p4|111810
ATGGACAGCATGTCGACGCAGGATAATGGCATAGAGACTGACCTTGAGGCGAGAGTCGGTTTGTGGGCTTGTTGC
GTCGGACGACCAAAATCACTTTGCTGCCAGATTTGGGGCCATTGACAAATAAAGGTAAATATAGTTGAGCCAAAT
AAAAATCGCCTTTCTATCTCGATCCTTTCCTCCTCGTCGACATTTGGATAGGTGAGTTTTCACACTTACTTTGAA
CATGATGCGGATAATAATCCTTATTTATTGTCAATGAAAAACAATGATCTCACTTCTTTTGCTGATTCTCTTTCC
TATGTGTTCGTGACGTAGTAAGCTGACCGATCCTTCCTAGGCAAAGTCGAATCAAACCCTCCAATCGTACTGTTC
ATATATATCCCATGTGAGTGTCGTTTCCTTAACCGAGTGCATCTCGGATGTGCATGACGTTCAAGTCCAACAAAC
ATGCTTCACACCCTCTACTGTGGCATCAGTCAGCTAACTAACAACTTCTTCTCAGATTAGTCTTCTGTCTTGAAT
CATGAATGCTCCCAATCGATATGAAATTTATGTGCTTGAGGATGGCGAAAAGCCGTGCGTTCAAACTATTGCGTA
ATCACCATGGAATAACTTGACCGAGCTCCTCGGGGTGGTCCACAGTGTGGAAGTGGTTGAAGACAGCAAGATTCC
TAATGCCGCAACTATCAAGATTTTGAAGCAGGATCATACTTTAGGCAACATGCTCCGCGCGTTCGTACTCTTTTT
CAACCTCGCCCTACCCCTCAACTGACGCATCGCATGACTCTTCAAAGTCAACTCCTCTCTATGCCTCAAATCCTC
TTCGCAGGTTATAAAGTCCCACATCCTCTCCACCCCTACTTCCTCATCAAGATCCAGACCGACGGAACCATCACA
CCACAAGAACTTCTCGAACAAGCTTGTACAAAGCTCATCGGAACCATGTCATCATTAGAAACGAAATTCAAGCGA
GAGTTTTCTTATAAGGATGTTGAAGGTACTGTTGGTGGTGTTACAGGTCATCTTGATGATCCTTATGGTGGAACG
GGTACAAGTGGAGGTGCTTGGTCTACAGGCAAAGATTATCTGGACCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail