Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|111740
Gene name
Locationscaffold_08:1385274..1388794
Strand+
Gene length (bp)3520
Transcript length (bp)2847
Coding sequence length (bp)2847
Protein length (aa) 949

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 2.0E-80 484 757
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 8.1E-33 76 199
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.4E-22 223 370
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 3.7E-11 872 934

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 77 877 3.0E-102
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 77 871 7.0E-90
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 77 845 4.0E-70
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 102 804 1.0E-43
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 102 804 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 77 877 3.0E-102
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 77 871 7.0E-90
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 77 845 4.0E-70
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 102 804 1.0E-43
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 102 804 2.0E-40
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 102 804 4.0E-38
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 113 882 1.0E-36
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 102 818 9.0E-36
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 428 937 8.0E-35
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 102 803 4.0E-34
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 331 753 3.0E-32
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 102 808 7.0E-32
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 151 753 6.0E-31
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 429 804 5.0E-30
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 76 761 2.0E-25
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 65 804 3.0E-22
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 429 818 2.0E-18
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 430 804 4.0E-18
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 429 808 2.0E-16
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 93 753 5.0E-15
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 428 736 1.0E-13
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 430 736 2.0E-13
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 102 231 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 132 154 22
2 178 197 19
3 484 506 22
4 526 557 31
5 577 599 22
6 627 649 22
7 669 691 22
8 738 760 22
9 767 789 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|111740
MSHELGKMNEWINEVDRSKAPFQKGISSTSDVNVFSIKTPSPGIVISPLPSPPRIRHGRNKRGEISLDRVVRDGS
AIYEPRTYAPAPSERSEPLSRNIFLWPVALWRADFRSIKHANGMDAYCFVRFLRMMVKVFLPIWIISWIVLLPTT
AVGTSNPGKDNLDKLTFGNVSPDQYKRYAAHLILAWFFTFWVLYNIVHEMRHFITARQQHIIEPNHAKSLQANTI
LVTGIPDRYLNRRSLLDLFDELPGGVKKIWINRNLKELPEIYSRRLSACNKLESAETALLRTAAKIRQREEKKKS
KASKKTVPVSKEHTHSHSEDLEIAAIVVPHGQRPTHRLGFLPFTGKKVDTIDWAREEIVTCNRLLEEGCAAIRAD
DEASNEVQNPGEFSSDASSAKLSLKPVAAIKNTTTAIKARFAGYGDSKYPPFNSAFVTFHKQIAAHLAVRVLTHH
EPYSMTNKYNEVSPQDVIWANLNMNPYEQKIRMAISYAITAALIIFWVIPVGFVGALSNVPSLCNQFSWLAWICG
LPPVIVGIISGVLPPVLLAILMALLPIVLRLLARFEGIPKYTGLELSLMTRFFIFQVVHSFLIVTVTSGIVAALE
GLVESPTSTPNILANELPKASTFFLTYIILQGLAGSGSGFLQIVRLVIYYVKLIVLGSTPRSVYNIKYVLGNVAW
GTLFPTITLLTVISLAYSIISPVINGLACATFFAFYQLYKYLFLWVYEQNPSGDTGGLFFPKAIQHVFVGLYIEE
ICLCALFFLARDPNDNASAVIEGALMIVLIVLTAGFHAIFNNSYDPLLQALPLSLKDKTYSPATGMTEGRGPRKS
EAGNSNHEIVEEMRGIEGDDEDDVSSKHKGKRPENENVGQVGEGTAARHTREDAEFGFAHPAISRPQRTLWIPRD
TLGLGEEEVAACEDMGLNASMSGAVMNEKGKVDVPSADDVPGEIVVRL*
Coding >Agabi119p4|111740
ATGAGCCATGAGCTGGGAAAGATGAATGAATGGATCAACGAAGTTGATCGATCGAAGGCGCCATTCCAAAAGGGG
ATATCATCCACTTCTGACGTCAATGTATTTTCTATAAAGACCCCGTCGCCTGGCATCGTAATTTCCCCCCTGCCT
TCCCCACCCAGGATCCGCCATGGCCGAAATAAACGAGGCGAAATCAGCCTCGACAGAGTCGTTCGTGACGGCTCT
GCAATCTATGAACCACGTACTTATGCCCCCGCACCTTCCGAACGTTCAGAACCCCTTTCTAGAAACATATTCCTG
TGGCCAGTGGCGCTATGGCGCGCCGACTTTCGCTCCATCAAGCATGCTAATGGTATGGATGCGTACTGTTTTGTG
CGCTTCCTTCGCATGATGGTTAAAGTGTTTTTACCCATCTGGATCATCTCTTGGATTGTTTTATTACCGACGACG
GCCGTTGGCACGTCGAACCCCGGCAAGGATAACCTCGACAAATTGACATTCGGCAATGTTTCTCCAGACCAATAT
AAGAGGTATGCAGCGCACTTGATTTTAGCTTGGTTTTTCACGTTTTGGGTTTTATACAATATCGTGCATGAAATG
CGCCATTTCATCACTGCTCGTCAACAACACATCATCGAGCCGAACCATGCAAAATCATTGCAGGCCAATACGATT
CTTGTAACGGGGATTCCTGACCGATATCTTAATCGACGTTCATTGCTTGATCTATTCGACGAGCTTCCTGGTGGA
GTCAAAAAGATTTGGATCAACCGTAACCTCAAAGAGTTACCTGAAATATATAGTCGTCGTCTCTCCGCTTGCAAT
AAACTCGAATCCGCAGAGACCGCTCTCCTTCGTACAGCTGCGAAAATACGGCAGCGGGAAGAGAAGAAGAAGAGT
AAAGCTTCAAAGAAGACGGTCCCGGTCTCGAAGGAGCATACTCATTCTCATTCAGAAGACCTTGAGATTGCTGCT
ATTGTTGTTCCGCACGGGCAACGACCCACCCATCGCCTAGGCTTCCTTCCTTTCACTGGTAAGAAGGTTGATACT
ATCGATTGGGCAAGGGAGGAGATCGTGACTTGCAACCGGCTACTCGAGGAAGGTTGTGCGGCCATTCGGGCAGAT
GATGAGGCTTCTAATGAAGTTCAAAATCCGGGGGAATTCTCCTCGGACGCGTCGTCTGCCAAGCTAAGTCTTAAA
CCTGTGGCTGCCATCAAAAATACTACCACAGCAATCAAAGCTCGCTTTGCAGGCTATGGAGATTCCAAATACCCC
CCCTTCAATAGCGCTTTCGTCACCTTCCATAAGCAGATTGCGGCTCATCTGGCGGTGAGAGTCCTCACGCACCAT
GAACCCTATAGTATGACAAATAAGTACAACGAAGTCAGCCCTCAAGATGTCATTTGGGCTAACTTGAATATGAAT
CCTTATGAGCAGAAGATTCGAATGGCTATCAGTTATGCTATCACAGCTGCTTTGATCATATTTTGGGTGATTCCT
GTTGGGTTCGTCGGTGCCCTTTCCAATGTTCCCAGCCTCTGCAATCAATTCAGCTGGCTTGCTTGGATCTGCGGT
TTACCGCCTGTCATCGTTGGCATAATTTCTGGTGTTCTTCCACCAGTACTACTCGCCATTCTCATGGCTCTTCTT
CCCATTGTCTTGAGACTCCTTGCCCGGTTTGAAGGGATTCCTAAATATACAGGGCTCGAGTTATCCTTGATGACT
CGATTTTTCATTTTCCAAGTTGTGCACTCTTTCCTCATCGTCACCGTTACTTCTGGTATCGTCGCAGCTCTTGAA
GGTCTCGTCGAAAGTCCGACATCTACACCTAATATCCTTGCCAATGAGCTACCAAAGGCTTCCACCTTCTTCTTG
ACTTACATCATTCTGCAAGGACTAGCCGGAAGTGGTAGTGGATTCCTACAGATCGTACGGCTGGTCATCTACTAT
GTCAAACTTATCGTCCTTGGTAGCACCCCGCGGTCAGTGTACAATATCAAATATGTATTGGGGAATGTAGCTTGG
GGAACTCTGTTTCCTACCATCACACTTCTTACCGTCATTTCGCTCGCGTACTCAATTATTTCTCCCGTCATTAAT
GGGTTGGCTTGCGCTACTTTCTTCGCGTTTTATCAACTCTACAAGTACCTTTTCCTGTGGGTATATGAACAGAAT
CCTTCCGGCGACACGGGAGGATTGTTTTTCCCTAAGGCTATCCAACATGTTTTTGTTGGACTCTACATCGAAGAG
ATCTGCTTGTGTGCGCTGTTCTTCCTTGCTCGCGATCCCAACGACAATGCAAGTGCCGTCATCGAAGGCGCCCTT
ATGATTGTCCTCATAGTCTTGACTGCTGGTTTCCATGCCATCTTCAACAATTCTTATGATCCGCTTTTACAAGCT
CTTCCCTTGAGCTTGAAGGACAAAACATATTCGCCCGCTACTGGCATGACTGAGGGACGTGGTCCCAGAAAGAGC
GAAGCTGGGAATAGCAACCACGAAATAGTAGAAGAAATGCGTGGTATAGAAGGAGATGATGAAGATGATGTGTCT
AGCAAGCATAAGGGAAAACGACCAGAGAACGAAAACGTTGGACAAGTTGGAGAAGGCACAGCTGCTAGACATACG
AGAGAGGACGCCGAATTTGGGTTTGCACATCCTGCGATCTCGAGACCACAGAGGACTTTATGGATACCGAGAGAC
ACGCTGGGTTTGGGTGAAGAAGAGGTTGCTGCTTGTGAGGATATGGGTCTCAATGCGAGTATGTCGGGCGCGGTT
ATGAATGAGAAGGGGAAGGTTGATGTGCCAAGTGCGGATGATGTGCCTGGAGAAATTGTGGTAAGGCTCTGA
Transcript >Agabi119p4|111740
ATGAGCCATGAGCTGGGAAAGATGAATGAATGGATCAACGAAGTTGATCGATCGAAGGCGCCATTCCAAAAGGGG
ATATCATCCACTTCTGACGTCAATGTATTTTCTATAAAGACCCCGTCGCCTGGCATCGTAATTTCCCCCCTGCCT
TCCCCACCCAGGATCCGCCATGGCCGAAATAAACGAGGCGAAATCAGCCTCGACAGAGTCGTTCGTGACGGCTCT
GCAATCTATGAACCACGTACTTATGCCCCCGCACCTTCCGAACGTTCAGAACCCCTTTCTAGAAACATATTCCTG
TGGCCAGTGGCGCTATGGCGCGCCGACTTTCGCTCCATCAAGCATGCTAATGGTATGGATGCGTACTGTTTTGTG
CGCTTCCTTCGCATGATGGTTAAAGTGTTTTTACCCATCTGGATCATCTCTTGGATTGTTTTATTACCGACGACG
GCCGTTGGCACGTCGAACCCCGGCAAGGATAACCTCGACAAATTGACATTCGGCAATGTTTCTCCAGACCAATAT
AAGAGGTATGCAGCGCACTTGATTTTAGCTTGGTTTTTCACGTTTTGGGTTTTATACAATATCGTGCATGAAATG
CGCCATTTCATCACTGCTCGTCAACAACACATCATCGAGCCGAACCATGCAAAATCATTGCAGGCCAATACGATT
CTTGTAACGGGGATTCCTGACCGATATCTTAATCGACGTTCATTGCTTGATCTATTCGACGAGCTTCCTGGTGGA
GTCAAAAAGATTTGGATCAACCGTAACCTCAAAGAGTTACCTGAAATATATAGTCGTCGTCTCTCCGCTTGCAAT
AAACTCGAATCCGCAGAGACCGCTCTCCTTCGTACAGCTGCGAAAATACGGCAGCGGGAAGAGAAGAAGAAGAGT
AAAGCTTCAAAGAAGACGGTCCCGGTCTCGAAGGAGCATACTCATTCTCATTCAGAAGACCTTGAGATTGCTGCT
ATTGTTGTTCCGCACGGGCAACGACCCACCCATCGCCTAGGCTTCCTTCCTTTCACTGGTAAGAAGGTTGATACT
ATCGATTGGGCAAGGGAGGAGATCGTGACTTGCAACCGGCTACTCGAGGAAGGTTGTGCGGCCATTCGGGCAGAT
GATGAGGCTTCTAATGAAGTTCAAAATCCGGGGGAATTCTCCTCGGACGCGTCGTCTGCCAAGCTAAGTCTTAAA
CCTGTGGCTGCCATCAAAAATACTACCACAGCAATCAAAGCTCGCTTTGCAGGCTATGGAGATTCCAAATACCCC
CCCTTCAATAGCGCTTTCGTCACCTTCCATAAGCAGATTGCGGCTCATCTGGCGGTGAGAGTCCTCACGCACCAT
GAACCCTATAGTATGACAAATAAGTACAACGAAGTCAGCCCTCAAGATGTCATTTGGGCTAACTTGAATATGAAT
CCTTATGAGCAGAAGATTCGAATGGCTATCAGTTATGCTATCACAGCTGCTTTGATCATATTTTGGGTGATTCCT
GTTGGGTTCGTCGGTGCCCTTTCCAATGTTCCCAGCCTCTGCAATCAATTCAGCTGGCTTGCTTGGATCTGCGGT
TTACCGCCTGTCATCGTTGGCATAATTTCTGGTGTTCTTCCACCAGTACTACTCGCCATTCTCATGGCTCTTCTT
CCCATTGTCTTGAGACTCCTTGCCCGGTTTGAAGGGATTCCTAAATATACAGGGCTCGAGTTATCCTTGATGACT
CGATTTTTCATTTTCCAAGTTGTGCACTCTTTCCTCATCGTCACCGTTACTTCTGGTATCGTCGCAGCTCTTGAA
GGTCTCGTCGAAAGTCCGACATCTACACCTAATATCCTTGCCAATGAGCTACCAAAGGCTTCCACCTTCTTCTTG
ACTTACATCATTCTGCAAGGACTAGCCGGAAGTGGTAGTGGATTCCTACAGATCGTACGGCTGGTCATCTACTAT
GTCAAACTTATCGTCCTTGGTAGCACCCCGCGGTCAGTGTACAATATCAAATATGTATTGGGGAATGTAGCTTGG
GGAACTCTGTTTCCTACCATCACACTTCTTACCGTCATTTCGCTCGCGTACTCAATTATTTCTCCCGTCATTAAT
GGGTTGGCTTGCGCTACTTTCTTCGCGTTTTATCAACTCTACAAGTACCTTTTCCTGTGGGTATATGAACAGAAT
CCTTCCGGCGACACGGGAGGATTGTTTTTCCCTAAGGCTATCCAACATGTTTTTGTTGGACTCTACATCGAAGAG
ATCTGCTTGTGTGCGCTGTTCTTCCTTGCTCGCGATCCCAACGACAATGCAAGTGCCGTCATCGAAGGCGCCCTT
ATGATTGTCCTCATAGTCTTGACTGCTGGTTTCCATGCCATCTTCAACAATTCTTATGATCCGCTTTTACAAGCT
CTTCCCTTGAGCTTGAAGGACAAAACATATTCGCCCGCTACTGGCATGACTGAGGGACGTGGTCCCAGAAAGAGC
GAAGCTGGGAATAGCAACCACGAAATAGTAGAAGAAATGCGTGGTATAGAAGGAGATGATGAAGATGATGTGTCT
AGCAAGCATAAGGGAAAACGACCAGAGAACGAAAACGTTGGACAAGTTGGAGAAGGCACAGCTGCTAGACATACG
AGAGAGGACGCCGAATTTGGGTTTGCACATCCTGCGATCTCGAGACCACAGAGGACTTTATGGATACCGAGAGAC
ACGCTGGGTTTGGGTGAAGAAGAGGTTGCTGCTTGTGAGGATATGGGTCTCAATGCGAGTATGTCGGGCGCGGTT
ATGAATGAGAAGGGGAAGGTTGATGTGCCAAGTGCGGATGATGTGCCTGGAGAAATTGTGGTAAGGCTCTGA
Gene >Agabi119p4|111740
ATGAGCCATGAGCTGGGAAAGTATGTGTCCATGAACTTCGAAGCCCGCCGCTGTACATTGCTAGAAGGCTCCGTT
GGACAGGATGAATGAATGGATCAACGAAGTTGATCGATCGAAGGCGCCATTCCAAAAGGGGATATCATCCACTTC
TGACGTCAATGTATTTTCTATAAAGACCCCGTCGCCTGGCATCGTAATTTCCCCCCTGCCTTCCCCACCCAGGAT
CCGCCATGTTCGTACGCCAGTCATATATAAACTCATGTCTTGTACTGACCAGATTCCGCAGGGCCGAAATAAACG
AGGCGAAATCAGCCTCGACAGAGTCGTTCGTGACGGCTCTGGTTTTCAATGCAATTGTTTTCGGCGTGGAAATCG
GAGTTTTCACACTCATTCGTCCTTATTTCAAAGCAATCTATGAACCACGTACTTATGCCCCCGCACCTTCGTATG
TCACTTGCGTTTTCAGAGCAATTGAAGAAGCTGACTGATTTGGTCTCCGCAGCGAACGTTCAGAACCCCTTTCTA
GAAACATATTCCTGTGGCCAGTGGCGCTATGGCGCGCCGACTTTCGCTCCATCAAGCATGCTAATGGTATGGATG
CGTACTGTTTTGTGCGCTTCCTTCGCATGATGGTTAAAGTGTTTTTACCCATCTGGATCATCTCTTGGATTGTTT
TATTACCGACGACGGCCGTTGGCACGTCGAACCCCGGCAAGGATAACCTCGACAAATTGACATTCGGCAATGTTT
CTCCAGACCAATATAAGAGGTATGCAGCGCACTTGATTTTAGCTTGGTTTTTCACGTGTGAGTCCGTTTCTCTTG
GCGACCGCATTTACTCTGACGCTTAACTTGACTAGTTTGGGTTTTATACAATATCGTGCATGAAATGCGCCATTT
CATCACTGCTCGTCAACAACACATCATCGAGCCGAACCATGCAAAATCATTGCAGGCCAATACGATTCTTGTAAC
GGGGATTCCTGACCGATATCTTAATCGACGTTCATTGCTTGATCTATTCGACGAGCTTCCTGGTGGAGTCAAAAA
GATTTGGATCAACCGTAACCTCAAAGAGTTACCTGAAATATATAGTCGTCGTCTCTCCGCTTGCAATAAACTCGA
ATCCGCAGAGACCGCTCTCCTTCGTACAGCTGCGAAAATACGGCAGCGGGAAGAGAAGAAGAAGAGTAAAGCTTC
AAAGAAGACGGTCCCGGTCTCGAAGGAGCATACTCATTCTCATTCAGAAGACCTTGAGATTGCTGCTATTGTTGT
TCCGCACGGGCAACGACCCACCCATCGCCTAGGCTTCCTTCCTTTCACTGGTAAGAAGGTTGATACTATCGATTG
GGCAAGGGAGGAGATCGTGACTTGCAACCGGCTACTCGAGGAAGGTTGTGCGGCCATTCGGGCAGATGATGAGGC
TTCTAATGAAGTTCAAAATCCGGGGGAATTCTCCTCGGACGCGTCGTCTGCCAAGCTAAGTACGTTTTTGTTGAG
CTTATCCACAAGTATCTGTAATAATTTTCCTGCTGTAGGTCTTAAACCTGTGGCTGCCATCAAAAATACTACCAC
AGCAATCAAAGCTCGCTTTGCAGGCTATGGAGATTCCAAATACCCCCCCTTCAATAGCGCTTTCGTCACCTTCCA
TAAGCAGATTGCGGCTCATCTGGCGGTGAGAGTCCTCACGCACCATGAACCCTATAGTATGAGTACGTACGTTCA
GTTTTTCGACATGATTTTCTTCTCAAGACATTTACAGCAAATAAGTACAACGAAGTCAGCCCTCAAGATGTCATT
TGGGCTAACTTGAATATGAATCCTTATGAGCAGAAGGTGAAGCTTTATCCATGAATTTCTTTTTGTGCCTAAGGC
TTCAACTCTCATTAATTTCAGATTCGAATGGCTATCAGTTATGCTATCACAGCTGCTTTGATCATATTTTGGGTG
ATTCCTGGTGAGCCCATCTCAAGCAGCAGAAAGAAATCCAAGTTTTTCTCATTCAAATAATAGTTGGGTTCGTCG
GTGCCCTTTCCAATGTTCCCAGCCTCTGCAATCAATTCAGCTGGCTTGCTTGGATCTGCGGTTTACCGCCTGTCA
TCGTTGGCATAATTTCTGGTGTTCTTCCACCAGTACTACTCGCCATTCTCATGGCTCTTCTTCCCATTGTCTTGA
GACTCCTTGCCCGGTTTGAAGGGATTCCTAAATATACAGGGCTCGAGTTATCCTTGATGACTCGATTTTTCATTT
TCCAAGTTGTGGTAAGCAAGATATTTCCTATCGGTAGCTCGACTTGAAGTTGTTTTTTTAGCACTCTTTCCTCAT
CGTCACCGTTACTTCTGGTATCGTCGCAGCTCTTGAAGGTCTCGTCGAAAGTCCGACATCTACACCTAATATCCT
TGCCAATGAGCTACCAAAGGCTTCCACCTTCTTCTTGACTTACATCATTCTGCAAGGACTAGCCGGAAGTGGTAG
TGGATTCCTACAGATCGTACGGCTGGTCATCTACTATGTCAAACTTATCGTCCTTGGTAGCACCCCGCGGTCAGT
GTACAATATCAAATATGTATTGGGGAATGTAGCTTGGGGAACTCTGTTTCCTACCATCACACTTCTTACCGTCAT
TTGTACGTTTCCAAACCTCGACTTTGCCTCTTGACTTATTGTGACCTTTATAGCGCTCGCGTACTCAATTATTTC
TCCCGTCATTAATGGGTTGGCTTGCGCTACTTTCTTCGCGTTTTATCAACTCTACAAGTACCTTTTCCTGTGGGT
ATATGAACAGAATCCTTCCGGCGACACGGGAGGATTGTTTTTCCCTAAGGCTATCCAACATGTTTTTGTTGGACT
CTACATCGAAGAGGTGAGCAAGCACCGTAAAATTTATGAAGAAATAGTAATTTTTACTATGTGACTTCCCTAGAT
CTGCTTGTGTGCGCTGTTCTTCCTTGCTCGCGATCCCAACGACAATGCAAGTGCCGTCATCGAAGGCGCCCTTAT
GATTGTCCTCATAGTCTTGACTGCTGGTTTCCATGCCATCTTCAACAATTCTTATGATCCGCTTTTACAAGCTCT
TCCCTTGAGCTTGAAGGACAAAACATATTCGCCCGCTACTGGCATGACTGAGGGACGTGGTCCCAGAAAGAGCGA
AGCTGGGAATAGCAACCACGAAATAGTAGAAGAAATGCGTGGTATAGAAGGAGATGATGAAGATGATGTGTCTAG
CAAGCATAAGGGAAAACGACCAGAGAACGAAAACGTTGGACAAGTTGGAGAAGGCACAGCTGCTAGACATACGAG
AGAGGACGCCGAATTTGGGTTTGCACATCCTGCGATCTCGAGACCACAGAGGACTTTATGGATACCGAGAGACAC
GCTGGGTTTGGGTGAAGAAGAGGTTGCTGCTTGTGAGGATATGGGTCTCAATGCGAGTATGTCGGGCGCGGTTAT
GAATGAGAAGGGGAAGGTTGATGTGCCAAGTGCGGATGATGTGCCTGGAGAAATTGTGGTAAGGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail