Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|111730
Gene name
Locationscaffold_08:1382406..1384295
Strand+
Gene length (bp)1889
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 1.5E-13 471 515
PF01363 FYVE FYVE zinc finger 1.1E-08 18 78
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 2.3E-08 473 517
PF13639 zf-RING_2 Ring finger domain 2.7E-06 473 512
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.5E-04 473 511

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q557E7|CBLA_DICDI E3 ubiquitin-protein ligase cblA OS=Dictyostelium discoideum GN=cblA-1 PE=1 SV=1 468 527 6.0E-07

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|111730
MATVHGIPLLSDSPPAIESDACRKCNKEFNLFFSRSRKCNHCGYSYCHSCSDFQALLPRSGSGSGYDSVHVCGYC
IELLNVTAAGPGRLRGMPLSKLKMYANSYNIDISRAVEKNDIIEAILNARGPNGCLPQSKEDFYRKNKVPNPHSG
SRPRGFFSRSNAGNPPSVPPRPPPPQGRSGGRDVPNPRPQYPQPQAPHTHYQPSYAASPQEHPYQPYTPPRNQPQ
HQPQQQYNAPPHHNFQHQPPPPQPPRETRPRPPSRSNSAAGNRSSRPPPRPRTPPRQRTTSSPSQPPPHSPPAPV
PTPTLDQLLVMTQSSIAALSVSVLKSILFMNHVNVTMVLEKSELVKKVVALVDDEKRERERQRMAEEAERFEEEE
RRREREEAIRREEEEREERLRKERQRNHRATVEDVEEGIDEMLDVEVDTVMDEDEDDDENEVDVHQGSSSANSQP
KISISSSPNHSIPAAVLERSGLCVICQDEEANIAIVDCGHMVMCRACSELIMHGSRECPLCRTRIVTEARLLRIF
KS*
Coding >Agabi119p4|111730
ATGGCCACAGTCCACGGCATTCCTCTCTTAAGTGACTCGCCACCCGCCATTGAGTCAGACGCTTGCAGGAAATGC
AACAAAGAATTCAATCTCTTCTTCTCGAGATCCAGAAAATGTAATCACTGTGGGTATTCCTATTGTCATTCGTGC
TCCGATTTCCAGGCACTGCTCCCTCGTTCGGGGTCCGGTAGCGGCTACGATTCTGTTCACGTCTGTGGGTACTGC
ATCGAGCTCTTAAATGTCACCGCCGCTGGGCCAGGTCGTTTGCGAGGGATGCCATTGAGCAAGCTTAAAATGTAT
GCCAACTCATACAATATCGACATTAGTCGGGCTGTAGAGAAAAATGATATCATAGAAGCAATTCTGAATGCAAGG
GGTCCTAATGGTTGTTTGCCTCAATCGAAAGAGGATTTCTACCGCAAGAACAAGGTACCAAATCCACATTCAGGA
AGCCGTCCCAGAGGTTTCTTCTCGCGCTCGAATGCTGGAAATCCGCCTTCAGTACCTCCCCGACCTCCGCCACCG
CAGGGACGATCTGGTGGGCGTGATGTACCCAATCCACGTCCACAATATCCACAACCTCAGGCTCCTCACACCCAC
TACCAACCCTCATATGCAGCCTCACCACAAGAACATCCTTATCAGCCATATACTCCTCCCCGTAATCAGCCGCAA
CATCAGCCGCAACAGCAGTATAATGCGCCACCCCATCATAACTTTCAGCATCAGCCGCCTCCCCCCCAGCCTCCG
CGAGAAACACGGCCACGGCCACCGTCTCGATCAAACTCGGCGGCTGGAAATCGATCTTCACGACCGCCGCCCCGT
CCACGAACCCCTCCGCGGCAACGCACCACTTCCTCTCCTTCGCAACCGCCACCACATTCACCTCCGGCCCCTGTG
CCAACACCAACTCTCGATCAACTCCTTGTGATGACACAATCGTCTATAGCAGCCTTATCAGTCAGCGTGTTGAAG
AGTATACTTTTTATGAACCACGTCAATGTTACTATGGTTTTGGAGAAGAGTGAGTTGGTAAAGAAGGTTGTGGCG
CTGGTTGATGATGAGAAGAGGGAGAGGGAGAGACAGAGGATGGCTGAGGAAGCGGAGAGGTTTGAAGAAGAGGAA
AGGAGGCGAGAAAGAGAGGAAGCGATTCGAAGAGAGGAAGAAGAAAGGGAGGAACGGTTGAGGAAAGAAAGACAG
AGAAATCATAGAGCGACGGTGGAAGATGTTGAAGAGGGTATAGATGAGATGTTGGATGTTGAGGTAGATACCGTC
ATGGATGAAGATGAAGATGACGATGAAAATGAAGTGGATGTTCATCAGGGATCATCGTCAGCGAATTCACAGCCC
AAGATTTCAATTTCGTCTTCACCGAATCATTCAATACCAGCAGCAGTATTGGAAAGGTCTGGTCTGTGTGTTATA
TGTCAAGACGAAGAAGCGAATATTGCCATAGTGGATTGTGGGCATATGGTGATGTGTCGGGCTTGTTCGGAATTG
ATTATGCATGGGTCGAGGGAATGTCCTTTGTGTCGGACTAGGATTGTGACTGAGGCTAGGTTGTTACGAATATTT
AAGTCGTAG
Transcript >Agabi119p4|111730
ATGGCCACAGTCCACGGCATTCCTCTCTTAAGTGACTCGCCACCCGCCATTGAGTCAGACGCTTGCAGGAAATGC
AACAAAGAATTCAATCTCTTCTTCTCGAGATCCAGAAAATGTAATCACTGTGGGTATTCCTATTGTCATTCGTGC
TCCGATTTCCAGGCACTGCTCCCTCGTTCGGGGTCCGGTAGCGGCTACGATTCTGTTCACGTCTGTGGGTACTGC
ATCGAGCTCTTAAATGTCACCGCCGCTGGGCCAGGTCGTTTGCGAGGGATGCCATTGAGCAAGCTTAAAATGTAT
GCCAACTCATACAATATCGACATTAGTCGGGCTGTAGAGAAAAATGATATCATAGAAGCAATTCTGAATGCAAGG
GGTCCTAATGGTTGTTTGCCTCAATCGAAAGAGGATTTCTACCGCAAGAACAAGGTACCAAATCCACATTCAGGA
AGCCGTCCCAGAGGTTTCTTCTCGCGCTCGAATGCTGGAAATCCGCCTTCAGTACCTCCCCGACCTCCGCCACCG
CAGGGACGATCTGGTGGGCGTGATGTACCCAATCCACGTCCACAATATCCACAACCTCAGGCTCCTCACACCCAC
TACCAACCCTCATATGCAGCCTCACCACAAGAACATCCTTATCAGCCATATACTCCTCCCCGTAATCAGCCGCAA
CATCAGCCGCAACAGCAGTATAATGCGCCACCCCATCATAACTTTCAGCATCAGCCGCCTCCCCCCCAGCCTCCG
CGAGAAACACGGCCACGGCCACCGTCTCGATCAAACTCGGCGGCTGGAAATCGATCTTCACGACCGCCGCCCCGT
CCACGAACCCCTCCGCGGCAACGCACCACTTCCTCTCCTTCGCAACCGCCACCACATTCACCTCCGGCCCCTGTG
CCAACACCAACTCTCGATCAACTCCTTGTGATGACACAATCGTCTATAGCAGCCTTATCAGTCAGCGTGTTGAAG
AGTATACTTTTTATGAACCACGTCAATGTTACTATGGTTTTGGAGAAGAGTGAGTTGGTAAAGAAGGTTGTGGCG
CTGGTTGATGATGAGAAGAGGGAGAGGGAGAGACAGAGGATGGCTGAGGAAGCGGAGAGGTTTGAAGAAGAGGAA
AGGAGGCGAGAAAGAGAGGAAGCGATTCGAAGAGAGGAAGAAGAAAGGGAGGAACGGTTGAGGAAAGAAAGACAG
AGAAATCATAGAGCGACGGTGGAAGATGTTGAAGAGGGTATAGATGAGATGTTGGATGTTGAGGTAGATACCGTC
ATGGATGAAGATGAAGATGACGATGAAAATGAAGTGGATGTTCATCAGGGATCATCGTCAGCGAATTCACAGCCC
AAGATTTCAATTTCGTCTTCACCGAATCATTCAATACCAGCAGCAGTATTGGAAAGGTCTGGTCTGTGTGTTATA
TGTCAAGACGAAGAAGCGAATATTGCCATAGTGGATTGTGGGCATATGGTGATGTGTCGGGCTTGTTCGGAATTG
ATTATGCATGGGTCGAGGGAATGTCCTTTGTGTCGGACTAGGATTGTGACTGAGGCTAGGTTGTTACGAATATTT
AAGTCGTAG
Gene >Agabi119p4|111730
ATGGCCACAGTCCACGGCATTCCTCTCTTAAGTGACTCGCCACCCGCCATTGAGTCAGACGCTTGCAGGAAATGC
AACAAAGAATTCAATCTCTTCTTCTCGAGATCCAGAAAATGTAATCACTGTGGTACGCTTTCCATTTCGTGGTTG
TTCTGCGGGTCGTGTTCATCGTTCATCTTAGGGTATTCCTATTGTCATTCGTGCTCCGATTTCCAGGCACTGCTC
CCTCGTTCGGGGTCCGGTAGCGGCTACGATTCTGTTCACGTCTGTGGGTACTGCATCGAGCTCTTAAATGGTGGG
AATCAAGTTTCTTGTTTGGGTTTCTTTGAGAAAGTTCATTTTGCCAATGACATATAGTCACCGCCGCTGGGCCAG
GTCGTTTGCGAGGGATGCCATTGAGCAAGCTTAAAATGTATGCCAACTCATACAATATCGACATTAGTCGGGCTG
TAGAGAAAAATGATATCATAGAAGCAATTCTGAATGCAAGGGCAAGTGGACGTTCACATGTTGCTTTGCGCCCAC
ATCTCTCATCGTCACCCTGCAGGGTCCTAATGGTTGTTTGCCTCAATCGAAAGAGGTAAGTGCTGCCAATCTCCC
TCATCTTCTTCCGTTTAAGGAAAAATGTTCAGGATTTCTACCGCAAGAACAAGGTACCAAATCCACATTCAGGAA
GCCGTCCCAGAGGTTTCTTCTCGCGCTCGAATGCTGGAAATCCGCCTTCAGTACCTCCCCGACCTCCGCCACCGC
AGGGACGATCTGGTGGGCGTGATGTACCCAATCCACGTCCACAATATCCACAACCTCAGGCTCCTCACACCCACT
ACCAACCCTCATATGCAGCCTCACCACAAGAACATCCTTATCAGCCATATACTCCTCCCCGTAATCAGCCGCAAC
ATCAGCCGCAACAGCAGTATAATGCGCCACCCCATCATAACTTTCAGCATCAGCCGCCTCCCCCCCAGCCTCCGC
GAGAAACACGGCCACGGCCACCGTCTCGATCAAACTCGGCGGCTGGAAATCGATCTTCACGACCGCCGCCCCGTC
CACGAACCCCTCCGCGGCAACGCACCACTTCCTCTCCTTCGCAACCGCCACCACATTCACCTCCGGCCCCTGTGC
CAACACCAACTCTCGATCAACTCCTTGTGATGACACAATCGTCTATAGCAGCCTTATCAGTCAGCGTGTTGAAGA
GTATACTTTTTATGAACCACGTCAATGTTACTATGGTTTTGGAGAAGAGTGAGTTGGTAAAGAAGGTTGTGGCGC
TGGTTGATGATGAGAAGAGGGAGAGGGAGAGACAGAGGATGGCTGAGGAAGCGGAGAGGTTTGAAGAAGAGGAAA
GGAGGCGAGAAAGAGAGGAAGCGATTCGAAGAGAGGAAGAAGAAAGGGAGGAACGGTTGAGGAAAGAAAGACAGA
GAAATCATAGAGCGACGGTGGAAGATGTTGAAGAGGGTATAGATGAGATGTTGGATGTTGAGGTAGATACCGTCA
TGGATGAAGATGAAGATGACGATGAAAATGAAGTGGATGTTCATCAGGGATCATCGTCAGCGAATTCACAGCCCA
AGATTTCAATTTCGTCTTCACCGAATCATTCAATACCAGCAGCAGTATTGGAAAGGTCTGGTCTGTGTGTTATAT
GTCAAGACGAAGAAGCGAATATTGCCATAGTGGATTGTGGGTACGTGGGGGTTTTTTTTTTCTCCTTTTTTTCAA
TCATCATTTTGGATTGCTAATTTTTGTTGTTCTTGTTCGAAAAAAGGCATATGGTGATGTGTCGGGCTTGTTCGG
AATTGATTATGCATGGGTCGAGGGAATGTCCTTTGTGTCGGACTAGGATTGTGACTGAGGCTAGGTTGTTACGAA
TATTTAAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail