Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|111720
Gene name
Locationscaffold_08:1381145..1382190
Strand-
Gene length (bp)1045
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.9E-34 4 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4V7R0|TIGAR_XENLA Fructose-2,6-bisphosphatase TIGAR OS=Xenopus laevis GN=tigar PE=2 SV=1 4 245 4.0E-18
sp|Q12040|YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR283W PE=1 SV=1 1 173 1.0E-17
sp|B1WAX6|TIGAR_XENTR Fructose-2,6-bisphosphatase TIGAR OS=Xenopus tropicalis GN=tigar PE=2 SV=1 4 159 4.0E-17
sp|Q8BZA9|TIGAR_MOUSE Fructose-2,6-bisphosphatase TIGAR OS=Mus musculus GN=Tigar PE=1 SV=1 4 157 1.0E-15
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 3 186 4.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4V7R0|TIGAR_XENLA Fructose-2,6-bisphosphatase TIGAR OS=Xenopus laevis GN=tigar PE=2 SV=1 4 245 4.0E-18
sp|Q12040|YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR283W PE=1 SV=1 1 173 1.0E-17
sp|B1WAX6|TIGAR_XENTR Fructose-2,6-bisphosphatase TIGAR OS=Xenopus tropicalis GN=tigar PE=2 SV=1 4 159 4.0E-17
sp|Q8BZA9|TIGAR_MOUSE Fructose-2,6-bisphosphatase TIGAR OS=Mus musculus GN=Tigar PE=1 SV=1 4 157 1.0E-15
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 3 186 4.0E-15
sp|Q1JQA7|TIGAR_BOVIN Fructose-2,6-bisphosphatase TIGAR OS=Bos taurus GN=TIGAR PE=2 SV=1 4 183 6.0E-15
sp|A1JJB8|GPMB_YERE8 Probable phosphoglycerate mutase GpmB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmB PE=3 SV=1 1 189 7.0E-15
sp|B9JYQ2|GPMA_AGRVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gpmA PE=3 SV=1 3 186 8.0E-15
sp|A4W6B3|GPMB_ENT38 Probable phosphoglycerate mutase GpmB OS=Enterobacter sp. (strain 638) GN=gpmB PE=3 SV=1 1 183 2.0E-14
sp|B5ZWT2|GPMA_RHILW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gpmA PE=3 SV=1 3 186 3.0E-14
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 1 222 4.0E-14
sp|Q38ZH8|GPMA1_LACSS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpmA1 PE=3 SV=1 1 187 5.0E-14
sp|A8G9J4|GPMB_SERP5 Probable phosphoglycerate mutase GpmB OS=Serratia proteamaculans (strain 568) GN=gpmB PE=3 SV=1 1 183 6.0E-14
sp|P36623|PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpm1 PE=1 SV=1 4 180 9.0E-14
sp|Q7N900|GPMB_PHOLL Probable phosphoglycerate mutase GpmB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmB PE=3 SV=1 1 189 1.0E-13
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 3 186 2.0E-13
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|A9WW62|GPMA_BRUSI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|A9MCX8|GPMA_BRUC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|Q576R3|GPMA_BRUAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|Q2YJN6|GPMA_BRUA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain 2308) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|B2SC37|GPMA_BRUA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain S19) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|B2VH13|GPMB_ERWT9 Probable phosphoglycerate mutase GpmB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpmB PE=3 SV=1 1 189 2.0E-13
sp|Q2YBZ1|GPMA1_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA1 PE=3 SV=1 1 95 3.0E-13
sp|B4EY52|GPMB_PROMH Probable phosphoglycerate mutase GpmB OS=Proteus mirabilis (strain HI4320) GN=gpmB PE=3 SV=1 1 183 3.0E-13
sp|Q9NQ88|TIGAR_HUMAN Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens GN=TIGAR PE=1 SV=1 4 183 4.0E-13
sp|Q6FZ12|GPMA_BARQU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella quintana (strain Toulouse) GN=gpmA PE=3 SV=1 3 186 5.0E-13
sp|A9IXE7|GPMA_BART1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gpmA PE=3 SV=1 3 186 5.0E-13
sp|B7LNT7|GPMB_ESCF3 Probable phosphoglycerate mutase GpmB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmB PE=3 SV=1 1 183 7.0E-13
sp|B9J6R3|GPMA_AGRRK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=gpmA PE=3 SV=1 3 186 7.0E-13
sp|Q7ZVE3|TIGRB_DANRE Fructose-2,6-bisphosphatase TIGAR B OS=Danio rerio GN=tigarb PE=1 SV=2 4 149 9.0E-13
sp|B3PXK3|GPMA_RHIE6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CIAT 652) GN=gpmA PE=3 SV=1 3 186 2.0E-12
sp|A1UTM4|GPMA_BARBK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gpmA PE=3 SV=1 3 192 2.0E-12
sp|Q732Z5|GPMA2_BACC1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpmA2 PE=3 SV=1 1 190 2.0E-12
sp|A9KN01|GPMA_CLOPH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gpmA PE=3 SV=1 2 186 3.0E-12
sp|B1JL20|GPMB_YERPY Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gpmB PE=3 SV=1 1 189 4.0E-12
sp|Q66EU3|GPMB_YERPS Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmB PE=3 SV=1 1 189 4.0E-12
sp|A4TQH5|GPMB_YERPP Probable phosphoglycerate mutase GpmB OS=Yersinia pestis (strain Pestoides F) GN=gpmB PE=3 SV=1 1 189 4.0E-12
sp|Q1CMX2|GPMB_YERPN Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmB PE=3 SV=1 1 189 4.0E-12
sp|A9R032|GPMB_YERPG Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gpmB PE=3 SV=1 1 189 4.0E-12
sp|Q8ZIP0|GPMB_YERPE Probable phosphoglycerate mutase GpmB OS=Yersinia pestis GN=gpmB PE=3 SV=1 1 189 4.0E-12
sp|B2K3K5|GPMB_YERPB Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gpmB PE=3 SV=1 1 189 4.0E-12
sp|Q1C0L5|GPMB_YERPA Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmB PE=3 SV=1 1 189 4.0E-12
sp|A7FMF8|GPMB_YERP3 Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmB PE=3 SV=1 1 189 4.0E-12
sp|A9MR94|GPMB_SALAR Probable phosphoglycerate mutase GpmB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gpmB PE=3 SV=1 1 183 4.0E-12
sp|B8GFF8|GPMA_METPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=gpmA PE=3 SV=1 1 180 4.0E-12
sp|C3MBY8|GPMA_RHISN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium sp. (strain NGR234) GN=gpmA PE=3 SV=1 3 186 5.0E-12
sp|Q8RFG9|GPMA_FUSNN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gpmA PE=3 SV=1 2 186 5.0E-12
sp|A6WYJ2|GPMA_OCHA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gpmA PE=3 SV=1 3 186 5.0E-12
sp|B0UBD4|GPMA_METS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium sp. (strain 4-46) GN=gpmA PE=3 SV=1 4 180 6.0E-12
sp|Q1MMY4|GPMA_RHIL3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gpmA PE=3 SV=1 3 186 7.0E-12
sp|Q88YY8|GPMA1_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA1 PE=3 SV=1 1 96 8.0E-12
sp|A4YJP8|GPMA_BRASO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain ORS278) GN=gpmA PE=3 SV=1 4 186 8.0E-12
sp|Q57G26|GPMB_SALCH Probable phosphoglycerate mutase GpmB OS=Salmonella choleraesuis (strain SC-B67) GN=gpmB PE=3 SV=1 1 183 9.0E-12
sp|B8EML2|GPMA_METSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gpmA PE=3 SV=1 4 186 9.0E-12
sp|Q8ZJU8|GPMB_SALTY Probable phosphoglycerate mutase GpmB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|B4TU55|GPMB_SALSV Probable phosphoglycerate mutase GpmB OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|A9N7F5|GPMB_SALPB Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|Q5PK44|GPMB_SALPA Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|B4T4I9|GPMB_SALNS Probable phosphoglycerate mutase GpmB OS=Salmonella newport (strain SL254) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|B4TH18|GPMB_SALHS Probable phosphoglycerate mutase GpmB OS=Salmonella heidelberg (strain SL476) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|B5R9W3|GPMB_SALG2 Probable phosphoglycerate mutase GpmB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|B5R3B7|GPMB_SALEP Probable phosphoglycerate mutase GpmB OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|B5FTD9|GPMB_SALDC Probable phosphoglycerate mutase GpmB OS=Salmonella dublin (strain CT_02021853) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|B5F543|GPMB_SALA4 Probable phosphoglycerate mutase GpmB OS=Salmonella agona (strain SL483) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|Q1R246|GPMB_ECOUT Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain UTI89 / UPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-11
sp|Q8FA40|GPMB_ECOL6 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-11
sp|Q0T8R6|GPMB_ECOL5 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-11
sp|A1AJW4|GPMB_ECOK1 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O1:K1 / APEC GN=gpmB PE=3 SV=1 1 183 2.0E-11
sp|B7MTE3|GPMB_ECO81 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O81 (strain ED1a) GN=gpmB PE=3 SV=1 1 183 2.0E-11
sp|B7NW76|GPMB_ECO7I Probable phosphoglycerate mutase GpmB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-11
sp|B7MNK4|GPMB_ECO45 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-11
sp|A9VFW9|GPMA_BACWK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus weihenstephanensis (strain KBAB4) GN=gpmA PE=3 SV=1 1 180 2.0E-11
sp|A6US15|GPMA_METVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gpmA PE=3 SV=1 1 186 3.0E-11
sp|Q73M14|GPMA_TREDE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gpmA PE=3 SV=1 2 186 3.0E-11
sp|B5Y264|GPMB_KLEP3 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae (strain 342) GN=gpmB PE=3 SV=1 1 183 3.0E-11
sp|A6TI09|GPMB_KLEP7 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmB PE=3 SV=1 1 183 3.0E-11
sp|Q5ZLN1|PGAM1_CHICK Phosphoglycerate mutase 1 OS=Gallus gallus GN=PGAM1 PE=1 SV=3 4 170 3.0E-11
sp|Q256A6|GPMA_CHLFF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila felis (strain Fe/C-56) GN=gpmA PE=3 SV=1 1 186 3.0E-11
sp|C0Q8F5|GPMB_SALPC Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi C (strain RKS4594) GN=gpmB PE=3 SV=1 1 183 3.0E-11
sp|Q3YTZ9|GPMB_SHISS Probable phosphoglycerate mutase GpmB OS=Shigella sonnei (strain Ss046) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|P0A7A4|GPMB_SHIFL Probable phosphoglycerate mutase GpmB OS=Shigella flexneri GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|Q0SX17|GPMB_SHIF8 Probable phosphoglycerate mutase GpmB OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|B1LEK2|GPMB_ECOSM Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|B6I6P3|GPMB_ECOSE Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SE11) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|B7NH70|GPMB_ECOLU Probable phosphoglycerate mutase GpmB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|P0A7A2|GPMB_ECOLI Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|B1IS24|GPMB_ECOLC Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|A8A8C4|GPMB_ECOHS Probable phosphoglycerate mutase GpmB OS=Escherichia coli O9:H4 (strain HS) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|B1XFK5|GPMB_ECODH Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / DH10B) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|C4ZT77|GPMB_ECOBW Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|B7LXV9|GPMB_ECO8A Probable phosphoglycerate mutase GpmB OS=Escherichia coli O8 (strain IAI1) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|B5Z4S7|GPMB_ECO5E Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|P0A7A3|GPMB_ECO57 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|B7LEP1|GPMB_ECO55 Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain 55989 / EAEC) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|A7ZVT7|GPMB_ECO24 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|Q31SU3|GPMB_SHIBS Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|B2TZS8|GPMB_SHIB3 Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|Q8Z0T4|GPMB_SALTI Probable phosphoglycerate mutase GpmB OS=Salmonella typhi GN=gpmB PE=3 SV=1 1 183 4.0E-11
sp|A5E8K1|GPMA_BRASB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gpmA PE=3 SV=1 4 186 4.0E-11
sp|A6UEW3|GPMA_SINMW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sinorhizobium medicae (strain WSM419) GN=gpmA PE=3 SV=1 3 186 6.0E-11
sp|A7IC75|GPMA_XANP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gpmA PE=3 SV=1 4 186 6.0E-11
sp|A7MIJ0|GPMB_CROS8 Probable phosphoglycerate mutase GpmB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmB PE=3 SV=1 1 183 7.0E-11
sp|Q6D7E3|GPMA_PECAS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gpmA PE=3 SV=1 1 180 7.0E-11
sp|Q92T25|GPMA_RHIME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium meliloti (strain 1021) GN=gpmA PE=3 SV=1 3 186 8.0E-11
sp|B1M6A7|GPMA_METRJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gpmA PE=3 SV=1 4 180 9.0E-11
sp|A4W897|GPMA_ENT38 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Enterobacter sp. (strain 638) GN=gpmA PE=3 SV=1 1 186 9.0E-11
sp|A6L9K8|GPMA_PARD8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gpmA PE=3 SV=1 1 186 1.0E-10
sp|Q5RFB8|PGAM1_PONAB Phosphoglycerate mutase 1 OS=Pongo abelii GN=PGAM1 PE=2 SV=3 4 186 1.0E-10
sp|Q3SZ62|PGAM1_BOVIN Phosphoglycerate mutase 1 OS=Bos taurus GN=PGAM1 PE=2 SV=3 4 186 1.0E-10
sp|P18669|PGAM1_HUMAN Phosphoglycerate mutase 1 OS=Homo sapiens GN=PGAM1 PE=1 SV=2 4 186 1.0E-10
sp|P25113|PGAM1_RAT Phosphoglycerate mutase 1 OS=Rattus norvegicus GN=Pgam1 PE=1 SV=4 4 186 1.0E-10
sp|Q9DBJ1|PGAM1_MOUSE Phosphoglycerate mutase 1 OS=Mus musculus GN=Pgam1 PE=1 SV=3 4 186 1.0E-10
sp|A8ALW1|GPMB_CITK8 Probable phosphoglycerate mutase GpmB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmB PE=3 SV=1 1 183 1.0E-10
sp|Q9PLK4|GPMA_CHLMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gpmA PE=3 SV=1 1 186 1.0E-10
sp|Q6MEW4|GPMA_PARUW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Protochlamydia amoebophila (strain UWE25) GN=gpmA PE=3 SV=1 1 184 1.0E-10
sp|Q64R85|GPMA_BACFR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacteroides fragilis (strain YCH46) GN=gpmA PE=3 SV=1 1 190 2.0E-10
sp|Q5LAT7|GPMA_BACFN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gpmA PE=3 SV=1 1 190 2.0E-10
sp|Q83FQ7|GPMA_TROWT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Tropheryma whipplei (strain Twist) GN=gpmA PE=3 SV=1 1 176 2.0E-10
sp|Q83HD5|GPMA_TROW8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Tropheryma whipplei (strain TW08/27) GN=gpmA PE=3 SV=1 1 176 2.0E-10
sp|A6LUA1|GPMA_CLOB8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=gpmA PE=3 SV=1 1 180 2.0E-10
sp|B1ZA86|GPMA_METPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gpmA PE=3 SV=1 4 180 2.0E-10
sp|Q49ZZ2|GPMA_STAS1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gpmA PE=3 SV=1 1 142 2.0E-10
sp|Q327K0|GPMB_SHIDS Probable phosphoglycerate mutase GpmB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmB PE=3 SV=1 1 183 2.0E-10
sp|B0BAH7|GPMA_CHLTB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gpmA PE=3 SV=1 1 186 2.0E-10
sp|Q7MXP1|GPMA_PORGI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=gpmA PE=3 SV=1 1 186 2.0E-10
sp|B2RHB7|GPMA_PORG3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=gpmA PE=3 SV=1 1 186 2.0E-10
sp|Q7VR80|GPMA_BLOFL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Blochmannia floridanus GN=gpmA PE=3 SV=1 1 184 2.0E-10
sp|B5BAL1|GPMB_SALPK Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmB PE=3 SV=1 1 183 3.0E-10
sp|O84727|GPMA_CHLTR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gpmA PE=3 SV=1 1 186 3.0E-10
sp|Q3KKX2|GPMA_CHLTA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gpmA PE=3 SV=1 1 186 3.0E-10
sp|A1JRT1|GPMA_YERE8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmA PE=3 SV=1 1 95 3.0E-10
sp|B0B8U8|GPMA_CHLT2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gpmA PE=3 SV=1 1 186 3.0E-10
sp|C6DCF6|GPMA_PECCP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gpmA PE=3 SV=1 1 180 3.0E-10
sp|Q9Z743|GPMA_CHLPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia pneumoniae GN=gpmA PE=3 SV=1 1 186 3.0E-10
sp|A1K9B9|GPMA_AZOSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azoarcus sp. (strain BH72) GN=gpmA PE=3 SV=1 1 180 4.0E-10
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 1 220 4.0E-10
sp|Q492W5|GPMA_BLOPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Blochmannia pennsylvanicus (strain BPEN) GN=gpmA PE=3 SV=1 1 184 5.0E-10
sp|B1JSU1|GPMA_YERPY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gpmA PE=3 SV=1 1 95 6.0E-10
sp|Q66D83|GPMA_YERPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmA PE=3 SV=1 1 95 6.0E-10
sp|A4TNS2|GPMA_YERPP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis (strain Pestoides F) GN=gpmA PE=3 SV=1 1 95 6.0E-10
sp|Q1CFN6|GPMA_YERPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmA PE=3 SV=1 1 95 6.0E-10
sp|A9R3B3|GPMA_YERPG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gpmA PE=3 SV=1 1 95 6.0E-10
sp|Q8ZGY5|GPMA_YERPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis GN=gpmA PE=3 SV=3 1 95 6.0E-10
sp|B2K8R3|GPMA_YERPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gpmA PE=3 SV=1 1 95 6.0E-10
sp|Q1C964|GPMA_YERPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmA PE=3 SV=1 1 95 6.0E-10
sp|A7FKP6|GPMA_YERP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmA PE=3 SV=1 1 95 6.0E-10
sp|B2IEV6|GPMA_BEII9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpmA PE=3 SV=1 4 186 6.0E-10
sp|Q9JYF7|GPMA_NEIMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gpmA PE=3 SV=1 2 95 7.0E-10
sp|A1KV25|GPMA_NEIMF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gpmA PE=3 SV=1 2 95 8.0E-10
sp|P82612|PMGY_CANAL Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPM1 PE=1 SV=3 1 96 8.0E-10
sp|A9M1A2|GPMA_NEIM0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gpmA PE=3 SV=1 2 95 8.0E-10
sp|Q9JTF2|GPMA_NEIMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gpmA PE=3 SV=1 2 95 8.0E-10
sp|Q07UT3|GPMA_RHOP5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisA53) GN=gpmA PE=3 SV=1 4 186 8.0E-10
sp|Q1QRT7|GPMA_NITHX 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gpmA PE=3 SV=1 4 186 9.0E-10
sp|B4RIY7|GPMA_NEIG2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gpmA PE=3 SV=1 2 95 9.0E-10
sp|Q5F7C0|GPMA_NEIG1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gpmA PE=3 SV=1 2 95 9.0E-10
sp|Q3SW71|GPMA_NITWN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gpmA PE=3 SV=1 4 186 9.0E-10
sp|A9W5P5|GPMA_METEP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium extorquens (strain PA1) GN=gpmA PE=3 SV=1 4 180 9.0E-10
sp|B7KNX9|GPMA_METC4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gpmA PE=3 SV=1 4 180 9.0E-10
sp|P15259|PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens GN=PGAM2 PE=1 SV=3 4 170 9.0E-10
sp|B2S2B5|GPMA_TREPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gpmA PE=3 SV=1 2 184 9.0E-10
sp|P96121|GPMA_TREPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum (strain Nichols) GN=gpmA PE=3 SV=1 2 184 9.0E-10
sp|B6JCI9|GPMA_OLICO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gpmA PE=3 SV=1 4 186 1.0E-09
sp|C0QV47|GPMA_BRAHW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gpmA PE=3 SV=1 1 180 1.0E-09
sp|Q88T35|GPMA2_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA2 PE=3 SV=1 1 95 1.0E-09
sp|Q660L2|GPMA_BORBP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=gpmA PE=3 SV=1 1 95 1.0E-09
sp|A7HZ35|GPMA_PARL1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpmA PE=3 SV=1 4 186 1.0E-09
sp|Q98DM0|GPMA_RHILO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium loti (strain MAFF303099) GN=gpmA PE=3 SV=1 3 180 1.0E-09
sp|Q89WK1|GPMA_BRADU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gpmA PE=3 SV=1 4 186 1.0E-09
sp|Q8CN61|GPMA_STAES 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gpmA PE=3 SV=1 1 186 1.0E-09
sp|B3QPN8|GPMA_CHLP8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gpmA PE=3 SV=1 1 95 2.0E-09
sp|A4SDM0|GPMA_CHLPM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gpmA PE=3 SV=1 1 95 2.0E-09
sp|P00950|PMG1_YEAST Phosphoglycerate mutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPM1 PE=1 SV=3 1 96 2.0E-09
sp|B7J2L3|GPMA_BORBZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ZS7) GN=gpmA PE=3 SV=1 1 95 2.0E-09
sp|O51602|GPMA_BORBU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gpmA PE=1 SV=2 1 95 2.0E-09
sp|A2SDN6|GPMA_METPP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylibium petroleiphilum (strain PM1) GN=gpmA PE=3 SV=1 1 95 2.0E-09
sp|Q21YW0|GPMA_RHOFT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gpmA PE=3 SV=1 1 95 2.0E-09
sp|B8F5J4|GPMA_HAEPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=gpmA PE=3 SV=1 2 95 2.0E-09
sp|Q8K9N1|GPMA_BUCAP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gpmA PE=3 SV=1 4 184 3.0E-09
sp|Q2FTH0|GPMA_METHJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gpmA PE=3 SV=1 1 95 3.0E-09
sp|Q5L4Y3|GPMA_CHLAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=gpmA PE=3 SV=1 1 186 3.0E-09
sp|A6T6I3|GPMA_KLEP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmA PE=3 SV=1 1 180 3.0E-09
sp|B5XZB2|GPMA_KLEP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Klebsiella pneumoniae (strain 342) GN=gpmA PE=3 SV=1 1 180 3.0E-09
sp|Q6GE17|GPMA_STAAR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain MRSA252) GN=gpmA PE=3 SV=1 1 180 3.0E-09
sp|O70250|PGAM2_MOUSE Phosphoglycerate mutase 2 OS=Mus musculus GN=Pgam2 PE=1 SV=3 4 170 3.0E-09
sp|Q821N6|GPMA_CHLCV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila caviae (strain GPIC) GN=gpmA PE=3 SV=1 1 186 3.0E-09
sp|B4RZM6|GPMA_ALTMD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=gpmA1 PE=3 SV=1 1 180 4.0E-09
sp|Q74L45|GPMA2_LACJO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gpmA2 PE=3 SV=1 1 180 4.0E-09
sp|A7MIX7|GPMA_CROS8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmA PE=3 SV=1 1 95 4.0E-09
sp|P16290|PGAM2_RAT Phosphoglycerate mutase 2 OS=Rattus norvegicus GN=Pgam2 PE=1 SV=2 4 95 4.0E-09
sp|Q8A8R2|GPMA1_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA1 PE=3 SV=1 1 180 4.0E-09
sp|P65709|GPMA_STAAW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain MW2) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|A8YYG4|GPMA_STAAT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|Q6G6Q5|GPMA_STAAS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain MSSA476) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|P99153|GPMA_STAAN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain N315) GN=gpmA PE=1 SV=1 1 180 4.0E-09
sp|P65708|GPMA_STAAM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|A6QJQ5|GPMA_STAAE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain Newman) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|Q5HDD9|GPMA_STAAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain COL) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|Q2YVZ6|GPMA_STAAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|A5IVJ6|GPMA_STAA9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain JH9) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|Q2FVK8|GPMA_STAA8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain NCTC 8325) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|Q2FE81|GPMA_STAA3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain USA300) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|A6U4E6|GPMA_STAA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain JH1) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|A7X656|GPMA_STAA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|C1CFM7|GPMA_STRZJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain JJA) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|P0A3Y4|GPMA_STRR6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|P0A3Y3|GPMA_STRPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|B1I720|GPMA_STRPI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|C1C8P5|GPMA_STRP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain 70585) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|B5E706|GPMA_STRP4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|Q04JB4|GPMA_STRP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|Q21CH5|GPMA_RHOPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisB18) GN=gpmA PE=3 SV=1 4 186 4.0E-09
sp|B5EC38|GPMA_GEOBB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|A5UHR1|GPMA_HAEIG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain PittGG) GN=gpmA PE=3 SV=1 2 95 4.0E-09
sp|A3CLS0|GPMA_STRSV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus sanguinis (strain SK36) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|A8IGZ9|GPMA_AZOC5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gpmA PE=3 SV=1 4 186 4.0E-09
sp|C1CSS1|GPMA_STRZT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|C1CLZ5|GPMA_STRZP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain P1031) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|B2IRR1|GPMA_STRPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain CGSP14) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|B8ZM52|GPMA_STRPJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|B7H7P4|GPMA_BACC4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain B4264) GN=gpmA PE=3 SV=1 1 180 5.0E-09
sp|Q82TU0|GPMA2_NITEU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gpmA2 PE=3 SV=1 1 180 5.0E-09
sp|Q03KA9|GPMA_STRTD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q8VVB5|GPMA_STRT2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q5LZF1|GPMA_STRT1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|A5UDW8|GPMA_HAEIE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain PittEE) GN=gpmA PE=3 SV=1 2 95 5.0E-09
sp|Q4QME2|GPMA_HAEI8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain 86-028NP) GN=gpmA PE=3 SV=1 2 95 5.0E-09
sp|Q8ZQS2|GPMA_SALTY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmA PE=3 SV=3 1 95 5.0E-09
sp|A9MTL3|GPMA_SALPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|B4TC26|GPMA_SALHS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella heidelberg (strain SL476) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|B5R739|GPMA_SALG2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|B5QX43|GPMA_SALEP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|B5F050|GPMA_SALA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella agona (strain SL483) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|Q38Z74|GPMA2_LACSS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpmA2 PE=3 SV=1 1 96 5.0E-09
sp|Q8Z8B2|GPMA_SALTI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella typhi GN=gpmA PE=3 SV=3 1 95 5.0E-09
sp|B4TQR7|GPMA_SALSV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|C0PWW0|GPMA_SALPC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi C (strain RKS4594) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|B4SZH5|GPMA_SALNS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella newport (strain SL254) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|Q57RI5|GPMA_SALCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella choleraesuis (strain SC-B67) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|B5XM69|GPMA_STRPZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|P0DD07|GPMA_STRPQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q48SP2|GPMA_STRPM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|A2RDV4|GPMA_STRPG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q1J5W1|GPMA_STRPF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q1JG44|GPMA_STRPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q1JL20|GPMA_STRPC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q1JAX0|GPMA_STRPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|P65711|GPMA_STRP8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q5XB88|GPMA_STRP6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gpmA PE=1 SV=1 1 96 5.0E-09
sp|P0DD06|GPMA_STRP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q99Z29|GPMA_STRP1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M1 GN=gpmA PE=3 SV=2 1 96 5.0E-09
sp|B5BC52|GPMA_SALPK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmA PE=3 SV=1 1 95 6.0E-09
sp|Q5PG75|GPMA_SALPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmA PE=3 SV=1 1 95 6.0E-09
sp|A8AW46|GPMA_STRGC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|B4EST0|GPMA_PROMH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Proteus mirabilis (strain HI4320) GN=gpmA PE=3 SV=1 1 186 6.0E-09
sp|B3QVL0|GPMA_CHLT3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gpmA PE=3 SV=1 1 95 6.0E-09
sp|B5FP39|GPMA_SALDC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella dublin (strain CT_02021853) GN=gpmA PE=3 SV=1 1 95 6.0E-09
sp|Q9CIM0|GPMA_LACLA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|Q3B5J2|GPMA_CHLL7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|Q3Z455|GPMA_SHISS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella sonnei (strain Ss046) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|P62710|GPMA_SHIFL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella flexneri GN=gpmA PE=3 SV=2 1 95 7.0E-09
sp|Q0T6Y5|GPMA_SHIF8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|Q324G4|GPMA_SHIBS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B2TUY6|GPMA_SHIB3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B7LK04|GPMA_ESCF3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B1LM46|GPMA_ECOSM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B6I7Q9|GPMA_ECOSE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain SE11) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B7N9Z7|GPMA_ECOLU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|P62707|GPMA_ECOLI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12) GN=gpmA PE=1 SV=2 1 95 7.0E-09
sp|B1IXY1|GPMA_ECOLC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|P62708|GPMA_ECOL6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmA PE=3 SV=2 1 95 7.0E-09
sp|Q0TJU6|GPMA_ECOL5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|A1A8Z8|GPMA_ECOK1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O1:K1 / APEC GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|A7ZY11|GPMA_ECOHS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O9:H4 (strain HS) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B1X786|GPMA_ECODH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12 / DH10B) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|C4ZXS6|GPMA_ECOBW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B7M6B8|GPMA_ECO8A 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O8 (strain IAI1) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B7MPN9|GPMA_ECO81 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O81 (strain ED1a) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B7NNH7|GPMA_ECO7I 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B5YRF2|GPMA_ECO5E 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|P62709|GPMA_ECO57 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O157:H7 GN=gpmA PE=3 SV=2 1 95 7.0E-09
sp|B7LAF6|GPMA_ECO55 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain 55989 / EAEC) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B7MGL2|GPMA_ECO45 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|B7ULM8|GPMA_ECO27 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|Q8KFC8|GPMA_CHLTE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gpmA PE=3 SV=1 1 95 8.0E-09
sp|C5BJ25|GPMA_TERTT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gpmA PE=3 SV=1 1 95 8.0E-09
sp|Q32IH0|GPMA_SHIDS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmA PE=3 SV=1 1 95 8.0E-09
sp|A7ZJD0|GPMA_ECO24 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmA PE=3 SV=1 1 95 8.0E-09
sp|A8GBA2|GPMA_SERP5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Serratia proteamaculans (strain 568) GN=gpmA PE=3 SV=1 1 95 9.0E-09
sp|Q81DD2|GPMA_BACCR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gpmA PE=3 SV=1 1 180 9.0E-09
sp|A8AJ40|GPMA_CITK8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmA PE=3 SV=1 1 95 9.0E-09
sp|P59161|GPMA_STRMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gpmA PE=3 SV=1 1 96 9.0E-09
sp|Q0SMJ5|GPMA_BORAP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia afzelii (strain PKo) GN=gpmA PE=3 SV=1 1 95 1.0E-08
sp|B9DUS6|GPMA_STRU0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gpmA PE=3 SV=1 1 96 1.0E-08
sp|A9IFJ0|GPMA_BORPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gpmA PE=3 SV=1 1 95 1.0E-08
sp|B7IX37|GPMA_BACC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain G9842) GN=gpmA PE=3 SV=1 1 180 1.0E-08
sp|B2JC95|GPMA_BURP8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gpmA PE=3 SV=1 1 95 1.0E-08
sp|Q5HLI0|GPMA_STAEQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gpmA PE=3 SV=1 1 186 1.0E-08
sp|B2S101|GPMA_BORHD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia hermsii (strain HS1 / DAH) GN=gpmA PE=3 SV=1 1 180 1.0E-08
sp|B1GZZ1|GPMA_UNCTG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gpmA PE=3 SV=1 1 95 2.0E-08
sp|C5BEL3|GPMA_EDWI9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Edwardsiella ictaluri (strain 93-146) GN=gpmA PE=3 SV=1 1 95 2.0E-08
sp|Q2NUK6|GPMA_SODGM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sodalis glossinidius (strain morsitans) GN=gpmA PE=3 SV=1 1 186 2.0E-08
sp|Q031Y3|GPMA_LACLS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gpmA PE=3 SV=1 1 95 2.0E-08
sp|A2RI67|GPMA_LACLM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gpmA PE=3 SV=1 1 95 2.0E-08
sp|Q63B92|GPMA_BACCZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain ZK / E33L) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|P44865|GPMA_HAEIN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gpmA PE=3 SV=1 2 95 2.0E-08
sp|B3EN99|GPMA_CHLPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeobacteroides (strain BS1) GN=gpmA PE=3 SV=1 1 96 2.0E-08
sp|Q97FJ6|GPMA_CLOAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|F4KI56|SERCL_ARATH Metal-independent phosphoserine phosphatase OS=Arabidopsis thaliana GN=IPSP PE=1 SV=1 4 170 2.0E-08
sp|Q6HIL9|GPMA_BACHK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|Q8P7A1|GPMA_XANCP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gpmA PE=3 SV=1 4 95 3.0E-08
sp|Q4UWV1|GPMA_XANC8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gpmA PE=3 SV=1 4 95 3.0E-08
sp|B0RQR7|GPMA_XANCB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas campestris pv. campestris (strain B100) GN=gpmA PE=3 SV=1 4 95 3.0E-08
sp|B0US27|GPMA_HISS2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Histophilus somni (strain 2336) GN=gpmA PE=3 SV=1 2 95 3.0E-08
sp|Q0I4D8|GPMA_HAES1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus somnus (strain 129Pt) GN=gpmA PE=3 SV=1 2 95 3.0E-08
sp|A7I8A7|GPMA_METB6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanoregula boonei (strain 6A8) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|Q9CKU9|GPMA_PASMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pasteurella multocida (strain Pm70) GN=gpmA PE=3 SV=1 2 95 3.0E-08
sp|Q63XU7|GPMA_BURPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain K96243) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|A3N5B0|GPMA_BURP6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain 668) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|Q3JWH7|GPMA_BURP1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain 1710b) GN=gpmA PE=1 SV=1 1 180 3.0E-08
sp|A3NR09|GPMA_BURP0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain 1106a) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|A1UZX9|GPMA_BURMS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain SAVP1) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|Q62F43|GPMA_BURMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain ATCC 23344) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|A2S625|GPMA_BURM9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain NCTC 10229) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|A3MQ23|GPMA_BURM7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain NCTC 10247) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|Q1LTL3|GPMA_BAUCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=gpmA PE=3 SV=1 4 190 3.0E-08
sp|C0MCW5|GPMA_STRS7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=gpmA PE=3 SV=1 1 96 4.0E-08
sp|B4U1Y5|GPMA_STREM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gpmA PE=3 SV=1 1 96 4.0E-08
sp|C0M8R8|GPMA_STRE4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus equi subsp. equi (strain 4047) GN=gpmA PE=3 SV=1 1 96 4.0E-08
sp|Q057P1|GPMA_BUCCC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=gpmA PE=3 SV=1 4 95 4.0E-08
sp|B2VBS6|GPMA_ERWT9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpmA PE=3 SV=1 1 95 4.0E-08
sp|Q11CB5|GPMA_CHESB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chelativorans sp. (strain BNC1) GN=gpmA PE=3 SV=1 3 155 4.0E-08
sp|Q8FSH0|GPMA_COREF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gpmA PE=3 SV=1 4 180 4.0E-08
sp|B4SEI0|GPMA_PELPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gpmA PE=3 SV=1 1 95 4.0E-08
sp|Q4L8T0|GPMA_STAHJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|A7GPN5|GPMA_BACCN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|B7JPK2|GPMA_BACC0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain AH820) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|Q6KSL4|GPMA_BACAN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus anthracis GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|C3LIE5|GPMA_BACAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|C3PAW8|GPMA_BACAA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus anthracis (strain A0248) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|B9J102|GPMA_BACCQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain Q1) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|B7HS46|GPMA_BACC7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain AH187) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|A1SP05|GPMA_NOCSJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=gpmA PE=3 SV=1 3 180 5.0E-08
sp|Q9A634|GPMA_CAUCR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gpmA PE=3 SV=1 1 183 5.0E-08
sp|B8GYN6|GPMA_CAUCN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gpmA PE=3 SV=1 1 183 5.0E-08
sp|Q7N6S0|GPMA_PHOLL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmA PE=3 SV=1 1 95 5.0E-08
sp|Q5FMJ3|GPMA_LACAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gpmA PE=3 SV=1 1 95 5.0E-08
sp|A1R083|GPMA_BORT9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia turicatae (strain 91E135) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|B0BPB3|GPMA_ACTPJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gpmA PE=3 SV=1 2 95 6.0E-08
sp|B3H1G9|GPMA_ACTP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gpmA PE=3 SV=1 2 95 6.0E-08
sp|A3N0J2|GPMA_ACTP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gpmA PE=3 SV=1 2 95 6.0E-08
sp|Q47KS8|GPMA_THEFY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermobifida fusca (strain YX) GN=gpmA PE=3 SV=1 1 96 6.0E-08
sp|Q74LL9|GPMA1_LACJO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gpmA1 PE=3 SV=1 1 95 7.0E-08
sp|B9DL85|GPMA_STACT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus carnosus (strain TM300) GN=gpmA PE=3 SV=1 1 155 7.0E-08
sp|C4K389|GPMA_HAMD5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gpmA PE=3 SV=1 4 95 7.0E-08
sp|Q71XG0|GPMA_LISMF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gpmA PE=3 SV=1 2 180 7.0E-08
sp|C1KXG0|GPMA_LISMC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gpmA PE=3 SV=1 2 180 7.0E-08
sp|Q7W1Q6|GPMA_BORPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gpmA PE=3 SV=1 1 95 8.0E-08
sp|C1EUQ5|GPMA_BACC3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain 03BB102) GN=gpmA PE=3 SV=1 1 95 9.0E-08
sp|A0RE96|GPMA_BACAH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis (strain Al Hakam) GN=gpmA PE=3 SV=1 1 95 9.0E-08
sp|A0AKV8|GPMA_LISW6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gpmA PE=3 SV=1 2 180 9.0E-08
sp|B4S616|GPMA_PROA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gpmA PE=3 SV=1 1 95 9.0E-08
sp|Q8E0G9|GPMA_STRA5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gpmA PE=3 SV=1 1 96 9.0E-08
sp|Q8E643|GPMA_STRA3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gpmA PE=3 SV=1 1 96 9.0E-08
sp|Q3K1U2|GPMA_STRA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gpmA PE=3 SV=1 1 96 9.0E-08
sp|Q32KV0|PGAM2_BOVIN Phosphoglycerate mutase 2 OS=Bos taurus GN=PGAM2 PE=2 SV=1 4 170 1.0E-07
sp|Q0KET8|GPMA_CUPNH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|A4W369|GPMA_STRS2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus suis (strain 98HAH33) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|Q2T1H5|GPMA_BURTA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|Q8Y571|GPMA_LISMO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gpmA PE=3 SV=1 2 180 1.0E-07
sp|B8DFA5|GPMA_LISMH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gpmA PE=3 SV=1 2 180 1.0E-07
sp|A4JI45|GPMA_BURVG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|B1Y3R5|GPMA_LEPCP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|Q39CN6|GPMA_BURL3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gpmA PE=3 SV=2 1 180 1.0E-07
sp|B1YNA6|GPMA_BURA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia ambifaria (strain MC40-6) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|Q7VS43|GPMA_BORPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|Q7WQN2|GPMA_BORBR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|Q476J7|GPMA_CUPPJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|Q15SN0|GPMA_PSEA6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gpmA PE=3 SV=1 1 170 1.0E-07
sp|Q737X5|GPMA1_BACC1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpmA1 PE=3 SV=1 1 95 1.0E-07
sp|B5RQ00|GPMA_BORRA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia recurrentis (strain A1) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|Q2L0A6|GPMA_BORA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella avium (strain 197N) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|Q3BR53|GPMA_XANC5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gpmA PE=3 SV=1 4 95 1.0E-07
sp|Q5H2V7|GPMA_XANOR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=gpmA PE=3 SV=1 4 95 1.0E-07
sp|Q2P5R0|GPMA_XANOM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gpmA PE=3 SV=1 4 95 1.0E-07
sp|B4EA64|GPMA_BURCJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|B1JZ61|GPMA_BURCC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia cenocepacia (strain MC0-3) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|Q0RS35|GPMA_FRAAA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Frankia alni (strain ACN14a) GN=gpmA PE=3 SV=1 1 95 2.0E-07
sp|Q2Y9Z7|GPMA2_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA2 PE=3 SV=1 1 95 2.0E-07
sp|Q0BBK5|GPMA_BURCM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gpmA PE=3 SV=1 1 180 2.0E-07
sp|Q8PIM1|GPMA_XANAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gpmA PE=3 SV=1 4 95 2.0E-07
sp|B2SX15|GPMA_BURPP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gpmA PE=3 SV=1 1 95 2.0E-07
sp|B3EFK8|GPMA_CHLL2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gpmA PE=3 SV=1 1 95 2.0E-07
sp|Q929G8|GPMA_LISIN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|Q7VL28|GPMA_HAEDU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|Q6NJL2|GPMA_CORDI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gpmA PE=3 SV=2 4 180 2.0E-07
sp|A5CTZ0|GPMA_CLAM3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=gpmA PE=3 SV=1 3 96 2.0E-07
sp|P30798|GPMA_ZYMMO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gpmA PE=1 SV=1 1 186 2.0E-07
sp|B0RAW4|GPMA_CLAMS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=gpmA PE=3 SV=1 3 96 2.0E-07
sp|A4T096|GPMA_POLSQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=gpmA PE=3 SV=1 1 186 2.0E-07
sp|Q3AU60|GPMA_CHLCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium chlorochromatii (strain CaD3) GN=gpmA PE=3 SV=1 1 95 2.0E-07
sp|Q8A765|GPMA2_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA2 PE=3 SV=1 1 95 2.0E-07
sp|A6VLV0|GPMA_ACTSZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|Q8NTA5|GPMA_CORGL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gpmA PE=3 SV=1 4 180 2.0E-07
sp|A4QB41|GPMA_CORGB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium glutamicum (strain R) GN=gpmA PE=3 SV=1 4 180 2.0E-07
sp|A9BUZ3|GPMA_DELAS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=gpmA PE=3 SV=1 1 95 3.0E-07
sp|Q65Q32|GPMA_MANSM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gpmA PE=3 SV=1 2 95 3.0E-07
sp|Q5P7N4|GPMA_AROAE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Aromatoleum aromaticum (strain EbN1) GN=gpmA PE=3 SV=1 1 180 3.0E-07
sp|B5RMK4|GPMA_BORDL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia duttonii (strain Ly) GN=gpmA PE=3 SV=1 1 95 3.0E-07
sp|C6E639|GPMA_GEOSM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter sp. (strain M21) GN=gpmA PE=3 SV=1 1 180 3.0E-07
sp|B1XS92|GPMA_POLNS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=gpmA PE=3 SV=1 1 180 3.0E-07
sp|C5CWV9|GPMA_VARPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Variovorax paradoxus (strain S110) GN=gpmA PE=3 SV=1 1 180 3.0E-07
sp|B2SRM8|GPMA_XANOP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=gpmA PE=3 SV=1 4 95 3.0E-07
sp|B4SPL6|GPMA_STRM5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gpmA PE=3 SV=1 4 95 3.0E-07
sp|Q8D2Y4|GPMA_WIGBR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Wigglesworthia glossinidia brevipalpis GN=gpmA PE=3 SV=1 1 184 4.0E-07
sp|B5Y7Q7|GPMA_COPPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gpmA PE=3 SV=1 1 186 4.0E-07
sp|Q89AJ4|GPMA_BUCBP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gpmA PE=3 SV=1 4 180 4.0E-07
sp|Q8R7C8|GPMA_CALS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gpmA PE=3 SV=1 1 95 5.0E-07
sp|Q8N0Y7|PGAM4_HUMAN Probable phosphoglycerate mutase 4 OS=Homo sapiens GN=PGAM4 PE=3 SV=1 4 170 5.0E-07
sp|B3DZZ7|GPMA_METI4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylacidiphilum infernorum (isolate V4) GN=gpmA PE=3 SV=1 2 180 5.0E-07
sp|Q4FP74|GPMA_PELUB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pelagibacter ubique (strain HTCC1062) GN=gpmA PE=3 SV=1 1 95 5.0E-07
sp|B2AGP7|GPMA_CUPTR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gpmA PE=3 SV=1 1 180 5.0E-07
sp|A1WDX2|GPMA_VEREI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Verminephrobacter eiseniae (strain EF01-2) GN=gpmA PE=3 SV=1 1 95 6.0E-07
sp|Q8MKE8|PGAM4_PANTR Probable phosphoglycerate mutase 4 OS=Pan troglodytes GN=PGAM4 PE=3 SV=1 4 170 6.0E-07
sp|C4LLD4|GPMA_CORK4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=gpmA PE=3 SV=1 4 180 6.0E-07
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 2 91 6.0E-07
sp|A1VKR6|GPMA_POLNA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polaromonas naphthalenivorans (strain CJ2) GN=gpmA PE=3 SV=1 1 95 7.0E-07
sp|A1TTW5|GPMA_ACIAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Acidovorax citrulli (strain AAC00-1) GN=gpmA PE=3 SV=1 1 95 7.0E-07
sp|B2FHH6|GPMA_STRMK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Stenotrophomonas maltophilia (strain K279a) GN=gpmA PE=3 SV=1 4 95 8.0E-07
sp|Q0A915|GPMA_ALKEH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gpmA PE=3 SV=1 1 186 8.0E-07
sp|B7KIT8|GPMA_CYAP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 7424) GN=gpmA PE=3 SV=1 1 186 9.0E-07
sp|Q6ADH3|GPMA_LEIXX 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=gpmA PE=3 SV=1 4 141 9.0E-07
sp|Q74CR0|GPMA_GEOSL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gpmA PE=3 SV=1 1 180 1.0E-06
sp|B9MEZ2|GPMA_ACIET 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Acidovorax ebreus (strain TPSY) GN=gpmA PE=3 SV=1 1 95 1.0E-06
sp|Q6MJP3|GPMA_BDEBA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gpmA PE=3 SV=1 1 95 1.0E-06
sp|B8D7J7|GPMA_BUCAT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=gpmA PE=3 SV=1 4 184 1.0E-06
sp|B8D995|GPMA_BUCA5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=gpmA PE=3 SV=1 4 184 1.0E-06
sp|B1VS80|GPMA_STRGG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gpmA PE=3 SV=1 4 96 2.0E-06
sp|A1WBJ3|GPMA_ACISJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Acidovorax sp. (strain JS42) GN=gpmA PE=3 SV=1 1 95 2.0E-06
sp|B6IYD3|GPMA_RHOCS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gpmA PE=3 SV=1 1 186 2.0E-06
sp|Q01YD0|GPMA_SOLUE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Solibacter usitatus (strain Ellin6076) GN=gpmA PE=3 SV=1 1 95 2.0E-06
sp|P57390|GPMA_BUCAI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gpmA PE=3 SV=1 4 184 2.0E-06
sp|B2KBU4|GPMA_ELUMP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Elusimicrobium minutum (strain Pei191) GN=gpmA PE=3 SV=1 1 95 2.0E-06
sp|Q82GB8|GPMA_STRAW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gpmA PE=3 SV=1 4 96 3.0E-06
sp|A1BE55|GPMA_CHLPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gpmA PE=3 SV=1 1 95 3.0E-06
sp|Q5YP50|GPMA_NOCFA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nocardia farcinica (strain IFM 10152) GN=gpmA PE=3 SV=1 3 96 3.0E-06
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 4 173 3.0E-06
sp|A5EV29|GPMA_DICNV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Dichelobacter nodosus (strain VCS1703A) GN=gpmA PE=3 SV=1 1 95 3.0E-06
sp|D3DFP8|PSPB_HYDTT Putative phosphoserine phosphatase 2 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspB PE=1 SV=1 1 100 3.0E-06
sp|B7GUR7|GPMA_BIFLS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=gpmA PE=3 SV=1 4 186 4.0E-06
sp|P59159|GPMA_BIFLO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain NCC 2705) GN=gpmA PE=3 SV=1 4 186 4.0E-06
sp|B3DQI6|GPMA_BIFLD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain DJO10A) GN=gpmA PE=3 SV=1 4 186 4.0E-06
sp|Q3JBA8|GPMA_NITOC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gpmA PE=3 SV=1 4 95 4.0E-06
sp|A0PVZ3|GPMA_MYCUA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Mycobacterium ulcerans (strain Agy99) GN=gpmA PE=3 SV=1 3 95 4.0E-06
sp|B0KBW9|GPMA_THEP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gpmA PE=3 SV=1 1 95 4.0E-06
sp|B0K4E2|GPMA_THEPX 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermoanaerobacter sp. (strain X514) GN=gpmA PE=3 SV=1 1 95 4.0E-06
sp|B2HQV4|GPMA_MYCMM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=gpmA PE=3 SV=1 3 95 4.0E-06
sp|Q82XS4|GPMA1_NITEU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gpmA1 PE=3 SV=1 2 98 5.0E-06
sp|Q4JSW4|GPMA_CORJK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium jeikeium (strain K411) GN=gpmA PE=3 SV=1 3 95 5.0E-06
sp|P33158|GPMA_STRCO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gpmA PE=1 SV=3 4 96 6.0E-06
sp|Q9PC88|GPMA_XYLFA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xylella fastidiosa (strain 9a5c) GN=gpmA PE=3 SV=1 4 95 6.0E-06
sp|B0SY17|GPMA_CAUSK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter sp. (strain K31) GN=gpmA PE=3 SV=1 1 95 6.0E-06
sp|B0U2F2|GPMA_XYLFM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xylella fastidiosa (strain M12) GN=gpmA PE=3 SV=1 4 95 6.0E-06
sp|C1AZ61|GPMA_RHOOB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodococcus opacus (strain B4) GN=gpmA PE=3 SV=1 3 96 6.0E-06
sp|Q0SF09|GPMA_RHOJR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodococcus jostii (strain RHA1) GN=gpmA PE=3 SV=1 3 96 7.0E-06
sp|A5VB15|GPMA_SPHWW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gpmA PE=3 SV=1 1 191 8.0E-06
sp|C4XIQ5|GPMA_DESMR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=gpmA PE=3 SV=1 1 95 8.0E-06
sp|Q8KL44|GPMA_RHIEC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gpmA PE=3 SV=1 1 183 8.0E-06
sp|B8HCQ9|GPMA_ARTCA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=gpmA PE=3 SV=1 4 96 9.0E-06
sp|A0JSU9|GPMA_ARTS2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Arthrobacter sp. (strain FB24) GN=gpmA PE=3 SV=1 4 96 9.0E-06
sp|B8DLN4|GPMA_DESVM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=gpmA PE=3 SV=1 1 95 9.0E-06
sp|Q73SU2|GPMA_MYCPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gpmA PE=3 SV=1 3 95 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|111720
MVTITLIRHGESRDNTKTIWAGWKDAPLSALGERQANAVGTYFHDSSIQFTHIYSSDLSRAHSTALAVLRHHAEP
KPPLVVTPKLREQHFGVAEGQPWTIDVYPGKSIEELSKEGTFPDFTSKGRDLKFPEGESLNDVAVRAEEAIKEFI
IPHVFAKDQEAVQIAFASHGICISETISALLRLDPEVEQLKEYKGHHNTGWSQVEISPKADHTGDYDPSSPPPVR
VRLLTFNNYGHLSSLPAPSSENAQARAFFSGSN*
Coding >Agabi119p4|111720
ATGGTCACTATTACTCTAATCCGGCACGGAGAAAGCAGGGATAACACTAAAACTATCTGGGCGGGCTGGAAAGAT
GCTCCGCTCTCAGCTCTAGGCGAACGTCAAGCAAATGCAGTCGGAACATATTTCCATGATTCTTCAATCCAATTT
ACCCATATCTATTCTTCTGATCTGAGTCGTGCACACTCTACCGCCCTCGCTGTGCTCCGTCACCACGCGGAGCCC
AAGCCCCCCCTAGTCGTCACTCCGAAATTACGAGAACAGCATTTCGGCGTAGCTGAAGGCCAACCATGGACCATC
GACGTATACCCTGGAAAATCTATAGAAGAACTATCCAAAGAAGGAACATTCCCGGACTTTACATCCAAAGGACGC
GATTTAAAGTTTCCTGAAGGGGAGAGTCTCAATGACGTTGCTGTTAGAGCGGAGGAGGCCATCAAGGAATTTATT
ATACCTCACGTTTTTGCCAAGGACCAAGAAGCTGTCCAGATTGCTTTTGCGAGTCATGGCATCTGTATATCAGAG
ACCATATCTGCCTTATTGAGGCTAGATCCAGAGGTCGAGCAGCTTAAAGAATACAAAGGCCATCACAACACTGGG
TGGAGTCAAGTAGAAATTTCTCCAAAGGCCGATCATACCGGTGACTATGACCCAAGTTCACCACCCCCCGTTCGA
GTTCGCCTGCTCACATTCAATAACTACGGACACCTTTCTTCCTTGCCTGCCCCTTCGAGTGAGAACGCGCAAGCA
CGTGCATTCTTTTCCGGCAGTAACTAA
Transcript >Agabi119p4|111720
ATGGTCACTATTACTCTAATCCGGCACGGAGAAAGCAGGGATAACACTAAAACTATCTGGGCGGGCTGGAAAGAT
GCTCCGCTCTCAGCTCTAGGCGAACGTCAAGCAAATGCAGTCGGAACATATTTCCATGATTCTTCAATCCAATTT
ACCCATATCTATTCTTCTGATCTGAGTCGTGCACACTCTACCGCCCTCGCTGTGCTCCGTCACCACGCGGAGCCC
AAGCCCCCCCTAGTCGTCACTCCGAAATTACGAGAACAGCATTTCGGCGTAGCTGAAGGCCAACCATGGACCATC
GACGTATACCCTGGAAAATCTATAGAAGAACTATCCAAAGAAGGAACATTCCCGGACTTTACATCCAAAGGACGC
GATTTAAAGTTTCCTGAAGGGGAGAGTCTCAATGACGTTGCTGTTAGAGCGGAGGAGGCCATCAAGGAATTTATT
ATACCTCACGTTTTTGCCAAGGACCAAGAAGCTGTCCAGATTGCTTTTGCGAGTCATGGCATCTGTATATCAGAG
ACCATATCTGCCTTATTGAGGCTAGATCCAGAGGTCGAGCAGCTTAAAGAATACAAAGGCCATCACAACACTGGG
TGGAGTCAAGTAGAAATTTCTCCAAAGGCCGATCATACCGGTGACTATGACCCAAGTTCACCACCCCCCGTTCGA
GTTCGCCTGCTCACATTCAATAACTACGGACACCTTTCTTCCTTGCCTGCCCCTTCGAGTGAGAACGCGCAAGCA
CGTGCATTCTTTTCCGGCAGTAACTAA
Gene >Agabi119p4|111720
ATGGTCACTATTACTCTAGTGAGTTGCGACTGATCTACTGCAAGCCGATCATTGTTCACCATTCTCTAGATCCGG
CACGGAGAAAGCAGGGATAACACTGTGGGTCCTTCCGTATGATCCGTCCAATAATAAACTGACTTTAGATAGAAA
ACTATCTGGGCGGGCTGGAAAGATGCTCCGCTCTCAGCTCTAGGCGAACGTGTAAGCCAGAAAACATCGCCTTTT
ATTTCACAACGTTGACCCAAAAAATCCAGCAAGCAAATGCAGTCGGAACATATTTCCATGATTCTTCAATCCAAT
TTACCCATATCTATTCTTCTGATCTGAGTCGTGCACACTCTACCGCCCTCGCTGTGCTCCGTCACCACGCGGAGC
CCAAGCCCCCCCTAGTCGTCACTCCGAAATTACGAGAACAGCATTTCGGCGTAGCTGAAGGCCAACCATGGACCA
TCGACGTATACCCTGGAAAATCTATAGAAGAACTATCCAAAGAAGGAACATTCCCGGACTTTACATCCAAAGGAC
GCGATTTAAAGTTTCCTGAAGGGGAGAGTCTCAATGACGTTGCTGTTAGAGCGGAGGAGGCCATCAAGGAATTTA
TTATACCTCACGTTTTTGCCAAGGACCAAGAAGCTGTCCAGATTGCTTTTGCGAGTCATGGCATCTGTATATCAG
AGACCATATCTGCCTTATTGAGGCTAGATCCAGAGGTCGAGCAGCTTAAAGAATACAAAGGCCATCACAACACTG
GGTGGAGTCAAGTAGAAATTTCTCCAAAGGTATATCGCAATCCATTATCGTCTCGTAGATTGACGAATACTGACC
CATCACATATATCTAGGCCGATCATACCGGTGACTATGACCCAAGTTCACCACCCCCCGTTCGAGTTCGCCTGCT
CACATTCAATAACTACGGACACCTTTCTTCCTTGGTATGTACATGGCAATTATCTTCACCATCAAGTCATTTGAC
ACCTGCTTACCAGCCTGCCCCTTCGAGTGAGAACGCGCAAGCACGTGCATTCTTTTCCGGCAGTAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail