Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|111660
Gene name
Locationscaffold_08:1372278..1373515
Strand-
Gene length (bp)1237
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.5E-11 57 125
PF13865 FoP_duplication C-terminal duplication domain of Friend of PRMT1 7.1E-07 180 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 10 146 2.0E-15
sp|Q58EA2|THO4A_XENLA THO complex subunit 4-A OS=Xenopus laevis GN=alyref-a PE=2 SV=1 10 149 3.0E-15
sp|B5FXN8|THOC4_TAEGU THO complex subunit 4 OS=Taeniopygia guttata GN=ALYREF PE=2 SV=1 10 131 4.0E-15
sp|O08583|THOC4_MOUSE THO complex subunit 4 OS=Mus musculus GN=Alyref PE=1 SV=3 10 131 6.0E-14
sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens GN=ALYREF PE=1 SV=3 10 131 7.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 10 146 2.0E-15
sp|Q58EA2|THO4A_XENLA THO complex subunit 4-A OS=Xenopus laevis GN=alyref-a PE=2 SV=1 10 149 3.0E-15
sp|B5FXN8|THOC4_TAEGU THO complex subunit 4 OS=Taeniopygia guttata GN=ALYREF PE=2 SV=1 10 131 4.0E-15
sp|O08583|THOC4_MOUSE THO complex subunit 4 OS=Mus musculus GN=Alyref PE=1 SV=3 10 131 6.0E-14
sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens GN=ALYREF PE=1 SV=3 10 131 7.0E-14
sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus GN=ALYREF PE=2 SV=1 10 131 8.0E-14
sp|Q6GLW1|THO4B_XENLA THO complex subunit 4-B OS=Xenopus laevis GN=alyref-b PE=2 SV=1 10 131 9.0E-14
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 16 144 1.0E-13
sp|Q9JJW6|ALRF2_MOUSE Aly/REF export factor 2 OS=Mus musculus GN=Alyref2 PE=1 SV=1 10 132 2.0E-13
sp|Q8L719|THO4B_ARATH THO complex subunit 4B OS=Arabidopsis thaliana GN=ALY2 PE=1 SV=1 10 155 4.0E-11
sp|Q94EH8|THO4C_ARATH THO complex subunit 4C OS=Arabidopsis thaliana GN=ALY3 PE=1 SV=1 57 150 2.0E-08
sp|B0BN49|RBMX2_RAT RNA-binding motif protein, X-linked 2 OS=Rattus norvegicus GN=Rbmx2 PE=2 SV=1 57 132 4.0E-08
sp|Q8R0F5|RBMX2_MOUSE RNA-binding motif protein, X-linked 2 OS=Mus musculus GN=Rbmx2 PE=1 SV=1 57 132 4.0E-08
sp|Q28BZ1|RBM8A_XENTR RNA-binding protein 8A OS=Xenopus tropicalis GN=rbm8a PE=2 SV=1 57 139 9.0E-08
sp|Q6PH90|RB8AB_XENLA RNA-binding protein 8A-B OS=Xenopus laevis GN=rbm8a-b PE=2 SV=1 57 139 1.0E-07
sp|Q9D0E1|HNRPM_MOUSE Heterogeneous nuclear ribonucleoprotein M OS=Mus musculus GN=Hnrnpm PE=1 SV=3 57 137 1.0E-07
sp|Q9DF42|RB8AA_XENLA RNA-binding protein 8A-A OS=Xenopus laevis GN=rbm8a-a PE=2 SV=1 57 139 1.0E-07
sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens GN=RBMX2 PE=1 SV=2 57 132 2.0E-07
sp|Q6NQ72|THO4D_ARATH THO complex subunit 4D OS=Arabidopsis thaliana GN=ALY4 PE=1 SV=1 56 132 3.0E-07
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 47 138 5.0E-07
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 57 137 8.0E-07
sp|P52272|HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens GN=HNRNPM PE=1 SV=3 57 137 8.0E-07
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 56 146 2.0E-06
sp|Q5D018|RBM8A_DANRE RNA-binding protein 8A OS=Danio rerio GN=rbm8a PE=2 SV=1 57 136 2.0E-06
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 52 153 2.0E-06
sp|Q9URV0|YBLC_SCHPO Uncharacterized RNA-binding protein C106.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC106.12c PE=3 SV=1 21 209 2.0E-06
sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 57 128 2.0E-06
sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 57 128 2.0E-06
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 56 137 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|111660
MASFKSTHKPYSRPTASRAPEGQWLHDKAPGSNIDIPRTSRPTAGGTTPSAAPTDKILVSNLHYEITPKDLNVIF
GQIGTLIREPLIRYDRSGRSSGQAIVSFETVAEAVRAKKQFNGILAKGQPMTVDFLAPRPPRGRSVSAPHGSLLN
RVQKPALLDRLAQDDSNIKTTSVRGVGPVRSKPGRATRPKKGPPKPPTAEELDKELDAFMGDSNTAGPAVEAPAD
TAVEAEKVPALAQDVEMA*
Coding >Agabi119p4|111660
ATGGCGTCGTTCAAATCAACTCACAAGCCGTACAGTCGGCCAACAGCCTCAAGAGCGCCTGAAGGCCAATGGCTA
CACGACAAGGCACCAGGTTCAAATATTGACATTCCGCGTACCTCCAGACCCACAGCGGGGGGGACCACCCCTTCT
GCAGCGCCGACGGACAAAATCCTGGTGTCAAATCTTCATTATGAAATTACGCCCAAGGATCTCAATGTCATTTTC
GGACAAATTGGCACACTCATACGTGAGCCACTAATCAGGTACGACCGCAGCGGCCGCTCATCTGGACAGGCGATT
GTCTCATTTGAAACGGTTGCTGAGGCTGTACGTGCCAAGAAACAGTTCAATGGTATTTTAGCCAAAGGACAACCT
ATGACGGTTGACTTCCTCGCACCAAGACCGCCGCGTGGCCGATCTGTCAGTGCACCACACGGTTCGTTACTCAAT
AGAGTTCAAAAGCCAGCACTGTTGGACCGGCTCGCTCAAGATGACTCTAATATCAAGACAACATCTGTTCGAGGT
GTTGGTCCCGTTCGCTCAAAACCTGGACGCGCCACGCGTCCGAAGAAGGGACCCCCAAAGCCCCCTACGGCCGAA
GAGTTGGATAAGGAGTTGGATGCCTTCATGGGTGATTCAAACACCGCCGGTCCTGCGGTCGAGGCCCCCGCTGAT
ACCGCTGTCGAGGCGGAGAAAGTGCCTGCGCTTGCCCAAGACGTTGAGATGGCTTAG
Transcript >Agabi119p4|111660
ATGGCGTCGTTCAAATCAACTCACAAGCCGTACAGTCGGCCAACAGCCTCAAGAGCGCCTGAAGGCCAATGGCTA
CACGACAAGGCACCAGGTTCAAATATTGACATTCCGCGTACCTCCAGACCCACAGCGGGGGGGACCACCCCTTCT
GCAGCGCCGACGGACAAAATCCTGGTGTCAAATCTTCATTATGAAATTACGCCCAAGGATCTCAATGTCATTTTC
GGACAAATTGGCACACTCATACGTGAGCCACTAATCAGGTACGACCGCAGCGGCCGCTCATCTGGACAGGCGATT
GTCTCATTTGAAACGGTTGCTGAGGCTGTACGTGCCAAGAAACAGTTCAATGGTATTTTAGCCAAAGGACAACCT
ATGACGGTTGACTTCCTCGCACCAAGACCGCCGCGTGGCCGATCTGTCAGTGCACCACACGGTTCGTTACTCAAT
AGAGTTCAAAAGCCAGCACTGTTGGACCGGCTCGCTCAAGATGACTCTAATATCAAGACAACATCTGTTCGAGGT
GTTGGTCCCGTTCGCTCAAAACCTGGACGCGCCACGCGTCCGAAGAAGGGACCCCCAAAGCCCCCTACGGCCGAA
GAGTTGGATAAGGAGTTGGATGCCTTCATGGGTGATTCAAACACCGCCGGTCCTGCGGTCGAGGCCCCCGCTGAT
ACCGCTGTCGAGGCGGAGAAAGTGCCTGCGCTTGCCCAAGACGTTGAGATGGCTTAG
Gene >Agabi119p4|111660
ATGGCGTCGTTCAAATCAACTCACAAGCCGTACAGTGTTAGCTGCCTATTGTGTTCTGCATTCGTTTCCTGACCA
ACGCGTTTTTGGGCTTCTGAAACACAGCGGCCAACAGCCTCAAGAGCGCCTGAAGGCCAATGGCTACACGACAAG
GCACCAGGTTCAAATATTGACATTCCGCGTACCTCCAGACCCACAGCGGGGGGGACCACCCCTTCTGCAGCGCCG
ACGGACAAAATCCTGGTGTCAAATCTTCATTATGAAATTACGCCCAAGGATCTCAATGTGCGTTCCTGTCCTTCT
TCCATTTTCCTTCCCTCTACGCGTAGCCATATGCAATGCGCCTCTAGCCTCGTTTTTCCTTCCCAACCCCATTCT
CGCCTATCTCGTACGCTGGTCTGGCCTTCATCTTACGTCAATACTTCTTCAGGTCATTTTCGGACAAATTGGCAC
ACTCATACGTGAGCCACTAATCAGGGTACGGCAAGCCCCCAAGCTCTCCCCTCCATTGAAGTAAAGAACAAACGC
CAATGAAAATTCGGACTTTTCACTTTTCTCTTACCTGACCTATTTCTTGGTTGCACATCACATTGCATCTGATCA
TTTCTCCTGATTACGTCAATGGGTTCACGTTGACGACTTGTTCTTGGGGATTTGATTGGCTTGTAATAGTACGAC
CGCAGCGGCCGCTCATCTGGACAGGCGATTGTCTCATTTGAAACGGTTGCTGAGGCTGTACGTGCCAAGAAACAG
TTCAATGGTATTTTAGCCAAAGGTGTGTGTATCTTACTTCCCAGTATAATCCGGATGATAACCACAACCCTAGGA
CAACCTATGACGGTTGACTTCCTCGCACCAAGACCGCCGCGTGGCCGATCTGTCAGTGCACCACACGGTTCGTTA
CTCAATAGAGTTCAAAAGCCAGCACTGTTGGACCGGCTCGCTCAAGATGACTCTAATATCAAGACAACATCTGTT
CGGTGAGTTCATATGACTGCAACTGCGTCTGGTTTTCTTATGGGTGAGCAGAGGTGTTGGTCCCGTTCGCTCAAA
ACCTGGACGCGCCACGCGTCCGAAGAAGGGACCCCCAAAGCCCCCTACGGCCGAAGAGTTGGATAAGGAGTTGGA
TGCCTTCATGGGTGATTCAAACACCGCCGGTCCTGCGGTCGAGGCCCCCGCTGATACCGCTGTCGAGGCGGAGAA
AGTGCCTGCGCTTGCCCAAGACGTTGAGATGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail