Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|111370
Gene name
Locationscaffold_08:1281931..1285125
Strand+
Gene length (bp)3194
Transcript length (bp)3135
Coding sequence length (bp)3135
Protein length (aa) 1045

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06428 Sec2p GDP/GTP exchange factor Sec2p 1.5E-13 126 213

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P17065|SEC2_YEAST Rab guanine nucleotide exchange factor SEC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC2 PE=1 SV=1 54 322 3.0E-12
sp|O13930|SEC2_SCHPO Rab guanine nucleotide exchange factor sec2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec2 PE=1 SV=1 273 352 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|111370
MAEDILDTHDPSSDQNGPGNNLRNGKTNHYAADPEAQEMVIESLRGQIQDLFSQVTQLNSKLVKSYDRVSDLEDN
LHVTSAQLRTSSVKVSQLELERTQHLAALNTGLLVEKHHVTTELNRLMEKATEEAAHRGQAESARAAIEKDLDDL
SASLFNQANTMVAEARYAKHLSERKAVDAEQALKSAEEAVSAMQQQVQNLQEDKETAEQKVEEMQTLIGLGEDNW
VATKNLEPLPPSLRLLGSHLPYQEFLSFVAHLRQLHVSSSNYPAMATLLSLPFLTRLSTEDSEPTLRLDLAPSLS
WLSRRSVFAAIHTGQLTIEPVSFATLIAESPQLSNTGISAAHNENIPCALCGTPIFPQAPSANTGSTRPPSNPLI
GMGHSYSGSIGSASSWSTNLFKKNPAHSTPPPAYSSFNPRTSQASSTPMYPSQVYIFRISSNQVSSNLPSLQLLK
SSAPTTTVSGSPTPSSFAYTPPLSHGHSAGGTPTQSSSTIYPLCTSGWCLARLRSTCSLWAFVRTGIVEKIWEEE
ISNITNPKQRPSSRRASVSHTQVAGASGAEKSSVPPKRRGLWGFASAIGASWSDSANDKDKARKPPSSSGTPEKE
IDEKKEVKPRTLPPPPPRHPRELGSSTPPPLPKRSEGRVRTPVPSSTPEPIATPETTTQSTQLDESNISDANVST
TVQNEKHAASPELSSPFPAVSGAPTSPISPNRTQRPMTPSTPPPPIPPRAAKRLSASVVRPGTPSSIPLPESRPD
TPVIGSGVIPNPPSRTASPALGSSSATDAPPPIPKRAASRRRLTGEIDPRPESPVAPSSPATKHEGQAQSVAALT
SSSQTQLDTVKEAVEEAKTENQDTETMEFTESPIAVKSVPSIASNTTTSGEEVFLDANDSSMAVEDEKEDKDKED
KADKEKEDEVEREKEDEAEVKTLKEEKGTKERSDEDMKQEKSKDANQLHNDQPAISLNEEDLPVPTYHALPPSPP
RLPPRRSEPVNGSRDIEKTKSLSSDNGSEVSEEGEAVYIGDSTWEEKTWKELTKLREGMYWARIGAVRV*
Coding >Agabi119p4|111370
ATGGCAGAAGATATTCTAGATACTCATGACCCGTCTTCAGATCAGAACGGTCCGGGGAACAATCTCCGCAATGGC
AAGACCAATCATTACGCAGCCGATCCCGAAGCTCAGGAGATGGTCATTGAGTCTTTGCGAGGTCAAATTCAGGAC
CTCTTCTCCCAAGTGACGCAACTTAATTCCAAACTTGTCAAGTCTTATGATCGTGTTTCTGACTTAGAGGACAAT
CTCCATGTCACCTCTGCTCAGCTACGGACTTCATCCGTTAAAGTTTCTCAGCTTGAGCTCGAAAGGACACAGCAC
CTTGCCGCTTTGAATACTGGGTTACTAGTCGAGAAGCACCATGTCACTACTGAGCTAAATCGGCTTATGGAAAAG
GCAACGGAAGAGGCCGCGCATCGAGGACAAGCCGAGAGTGCTCGCGCCGCCATTGAAAAGGATCTTGATGACCTC
AGTGCCTCCTTGTTCAACCAGGCGAACACCATGGTGGCCGAGGCACGCTATGCGAAGCACCTCAGTGAAAGGAAA
GCTGTAGATGCCGAGCAGGCCCTCAAGAGCGCAGAGGAAGCCGTCAGCGCAATGCAGCAGCAGGTTCAAAATTTG
CAGGAAGACAAAGAGACCGCAGAACAGAAGGTTGAAGAAATGCAGACCCTCATCGGCTTGGGTGAAGATAATTGG
GTTGCCACAAAGAATCTCGAACCTCTCCCTCCTTCTCTTCGTCTTCTTGGTTCCCACCTTCCCTACCAAGAATTC
CTTTCCTTTGTCGCTCATCTTCGACAGCTCCACGTGAGCTCTTCAAACTATCCAGCGATGGCTACCCTTCTTTCT
CTGCCCTTTCTGACGCGGTTATCAACTGAAGACTCAGAACCCACCTTACGACTAGACCTCGCACCGTCGTTGAGC
TGGTTATCCAGGCGTTCCGTTTTTGCTGCTATACATACTGGACAGCTCACCATTGAACCGGTGTCTTTCGCGACT
TTGATTGCTGAATCGCCTCAGTTATCGAATACAGGAATTTCTGCTGCTCATAACGAGAATATTCCGTGTGCTCTT
TGTGGGACACCCATCTTTCCTCAGGCCCCGTCGGCAAACACGGGTTCAACCCGACCTCCTTCTAATCCTCTCATA
GGTATGGGGCACTCTTATTCCGGGTCTATCGGGTCTGCGTCTTCATGGTCCACCAACCTATTCAAGAAAAACCCC
GCTCACTCAACCCCGCCTCCCGCCTACTCAAGTTTTAATCCTCGTACCAGTCAAGCTTCATCCACACCTATGTAT
CCATCTCAAGTCTATATCTTCCGCATCTCATCAAATCAAGTATCGTCCAATCTACCCAGCCTACAATTGCTCAAA
TCATCAGCCCCTACAACTACTGTGTCTGGTTCACCGACGCCCTCCTCATTTGCATATACTCCACCCTTGTCCCAC
GGTCACTCGGCTGGAGGAACACCTACTCAATCAAGTAGCACGATATATCCGCTTTGCACGAGTGGCTGGTGTCTC
GCCCGTCTTCGCTCTACATGTTCATTATGGGCCTTTGTCCGAACTGGCATTGTAGAGAAAATCTGGGAAGAGGAA
ATTTCTAACATCACCAACCCTAAGCAAAGACCATCATCTAGAAGGGCATCCGTATCACATACTCAAGTTGCTGGC
GCATCTGGTGCTGAAAAATCTTCTGTGCCTCCAAAGAGGAGGGGCTTGTGGGGCTTTGCTAGCGCTATCGGAGCG
AGCTGGAGTGATAGCGCGAATGACAAGGATAAGGCGAGAAAACCACCCAGTTCTTCTGGGACACCAGAGAAGGAA
ATTGACGAAAAGAAAGAAGTGAAACCGAGGACATTGCCTCCCCCACCACCTCGGCATCCCCGGGAGCTTGGAAGT
AGTACGCCTCCCCCTCTCCCCAAGCGTAGCGAAGGCCGGGTTCGAACTCCAGTACCTTCCTCCACGCCAGAGCCC
ATAGCCACTCCAGAGACAACAACTCAGTCTACCCAACTAGATGAAAGCAATATTTCCGATGCTAACGTGTCTACT
ACGGTTCAGAATGAAAAGCACGCTGCCTCACCAGAACTTTCTTCTCCATTTCCAGCCGTCAGTGGCGCACCAACT
TCCCCAATTTCCCCGAATCGAACACAGCGTCCCATGACTCCGTCGACACCACCACCACCAATTCCTCCTCGTGCC
GCCAAAAGACTCTCGGCATCAGTCGTTCGACCTGGTACACCTTCTAGTATACCATTACCTGAGTCCCGTCCTGAT
ACCCCTGTCATTGGTTCTGGTGTTATACCCAACCCTCCATCCCGCACTGCCTCGCCCGCACTTGGAAGTTCGTCT
GCGACTGATGCTCCTCCACCTATTCCTAAACGTGCCGCTTCAAGAAGACGGCTTACCGGGGAAATCGATCCAAGG
CCTGAATCGCCAGTGGCACCTAGCTCTCCTGCCACAAAGCATGAAGGTCAAGCTCAGAGTGTAGCTGCTTTGACA
TCTTCATCTCAGACTCAATTGGATACCGTAAAAGAGGCTGTTGAGGAAGCTAAAACAGAGAATCAAGATACCGAG
ACGATGGAGTTTACTGAATCGCCGATAGCGGTAAAATCGGTTCCCAGTATTGCCTCAAACACTACAACTTCCGGG
GAGGAGGTTTTCTTGGATGCTAACGATAGTTCTATGGCAGTGGAGGATGAGAAAGAGGATAAGGACAAAGAAGAT
AAAGCTGATAAGGAGAAAGAGGACGAAGTCGAGAGGGAGAAAGAGGATGAAGCTGAGGTCAAGACGTTGAAGGAG
GAAAAGGGAACGAAGGAACGCTCAGACGAGGACATGAAGCAAGAGAAGTCGAAAGATGCAAATCAACTACACAAT
GATCAACCTGCCATCTCGCTGAACGAAGAGGATCTACCTGTTCCTACCTATCATGCCTTACCACCCTCACCACCC
CGTCTACCACCTCGTAGGTCTGAACCCGTGAATGGAAGTCGGGACATAGAGAAAACAAAGAGTCTTAGTAGTGAT
AATGGCTCGGAGGTTAGTGAAGAGGGAGAAGCGGTATACATCGGTGATAGTACATGGGAGGAAAAGACGTGGAAA
GAATTGACAAAACTCCGCGAAGGAATGTACTGGGCGAGGATTGGCGCTGTTCGAGTATAA
Transcript >Agabi119p4|111370
ATGGCAGAAGATATTCTAGATACTCATGACCCGTCTTCAGATCAGAACGGTCCGGGGAACAATCTCCGCAATGGC
AAGACCAATCATTACGCAGCCGATCCCGAAGCTCAGGAGATGGTCATTGAGTCTTTGCGAGGTCAAATTCAGGAC
CTCTTCTCCCAAGTGACGCAACTTAATTCCAAACTTGTCAAGTCTTATGATCGTGTTTCTGACTTAGAGGACAAT
CTCCATGTCACCTCTGCTCAGCTACGGACTTCATCCGTTAAAGTTTCTCAGCTTGAGCTCGAAAGGACACAGCAC
CTTGCCGCTTTGAATACTGGGTTACTAGTCGAGAAGCACCATGTCACTACTGAGCTAAATCGGCTTATGGAAAAG
GCAACGGAAGAGGCCGCGCATCGAGGACAAGCCGAGAGTGCTCGCGCCGCCATTGAAAAGGATCTTGATGACCTC
AGTGCCTCCTTGTTCAACCAGGCGAACACCATGGTGGCCGAGGCACGCTATGCGAAGCACCTCAGTGAAAGGAAA
GCTGTAGATGCCGAGCAGGCCCTCAAGAGCGCAGAGGAAGCCGTCAGCGCAATGCAGCAGCAGGTTCAAAATTTG
CAGGAAGACAAAGAGACCGCAGAACAGAAGGTTGAAGAAATGCAGACCCTCATCGGCTTGGGTGAAGATAATTGG
GTTGCCACAAAGAATCTCGAACCTCTCCCTCCTTCTCTTCGTCTTCTTGGTTCCCACCTTCCCTACCAAGAATTC
CTTTCCTTTGTCGCTCATCTTCGACAGCTCCACGTGAGCTCTTCAAACTATCCAGCGATGGCTACCCTTCTTTCT
CTGCCCTTTCTGACGCGGTTATCAACTGAAGACTCAGAACCCACCTTACGACTAGACCTCGCACCGTCGTTGAGC
TGGTTATCCAGGCGTTCCGTTTTTGCTGCTATACATACTGGACAGCTCACCATTGAACCGGTGTCTTTCGCGACT
TTGATTGCTGAATCGCCTCAGTTATCGAATACAGGAATTTCTGCTGCTCATAACGAGAATATTCCGTGTGCTCTT
TGTGGGACACCCATCTTTCCTCAGGCCCCGTCGGCAAACACGGGTTCAACCCGACCTCCTTCTAATCCTCTCATA
GGTATGGGGCACTCTTATTCCGGGTCTATCGGGTCTGCGTCTTCATGGTCCACCAACCTATTCAAGAAAAACCCC
GCTCACTCAACCCCGCCTCCCGCCTACTCAAGTTTTAATCCTCGTACCAGTCAAGCTTCATCCACACCTATGTAT
CCATCTCAAGTCTATATCTTCCGCATCTCATCAAATCAAGTATCGTCCAATCTACCCAGCCTACAATTGCTCAAA
TCATCAGCCCCTACAACTACTGTGTCTGGTTCACCGACGCCCTCCTCATTTGCATATACTCCACCCTTGTCCCAC
GGTCACTCGGCTGGAGGAACACCTACTCAATCAAGTAGCACGATATATCCGCTTTGCACGAGTGGCTGGTGTCTC
GCCCGTCTTCGCTCTACATGTTCATTATGGGCCTTTGTCCGAACTGGCATTGTAGAGAAAATCTGGGAAGAGGAA
ATTTCTAACATCACCAACCCTAAGCAAAGACCATCATCTAGAAGGGCATCCGTATCACATACTCAAGTTGCTGGC
GCATCTGGTGCTGAAAAATCTTCTGTGCCTCCAAAGAGGAGGGGCTTGTGGGGCTTTGCTAGCGCTATCGGAGCG
AGCTGGAGTGATAGCGCGAATGACAAGGATAAGGCGAGAAAACCACCCAGTTCTTCTGGGACACCAGAGAAGGAA
ATTGACGAAAAGAAAGAAGTGAAACCGAGGACATTGCCTCCCCCACCACCTCGGCATCCCCGGGAGCTTGGAAGT
AGTACGCCTCCCCCTCTCCCCAAGCGTAGCGAAGGCCGGGTTCGAACTCCAGTACCTTCCTCCACGCCAGAGCCC
ATAGCCACTCCAGAGACAACAACTCAGTCTACCCAACTAGATGAAAGCAATATTTCCGATGCTAACGTGTCTACT
ACGGTTCAGAATGAAAAGCACGCTGCCTCACCAGAACTTTCTTCTCCATTTCCAGCCGTCAGTGGCGCACCAACT
TCCCCAATTTCCCCGAATCGAACACAGCGTCCCATGACTCCGTCGACACCACCACCACCAATTCCTCCTCGTGCC
GCCAAAAGACTCTCGGCATCAGTCGTTCGACCTGGTACACCTTCTAGTATACCATTACCTGAGTCCCGTCCTGAT
ACCCCTGTCATTGGTTCTGGTGTTATACCCAACCCTCCATCCCGCACTGCCTCGCCCGCACTTGGAAGTTCGTCT
GCGACTGATGCTCCTCCACCTATTCCTAAACGTGCCGCTTCAAGAAGACGGCTTACCGGGGAAATCGATCCAAGG
CCTGAATCGCCAGTGGCACCTAGCTCTCCTGCCACAAAGCATGAAGGTCAAGCTCAGAGTGTAGCTGCTTTGACA
TCTTCATCTCAGACTCAATTGGATACCGTAAAAGAGGCTGTTGAGGAAGCTAAAACAGAGAATCAAGATACCGAG
ACGATGGAGTTTACTGAATCGCCGATAGCGGTAAAATCGGTTCCCAGTATTGCCTCAAACACTACAACTTCCGGG
GAGGAGGTTTTCTTGGATGCTAACGATAGTTCTATGGCAGTGGAGGATGAGAAAGAGGATAAGGACAAAGAAGAT
AAAGCTGATAAGGAGAAAGAGGACGAAGTCGAGAGGGAGAAAGAGGATGAAGCTGAGGTCAAGACGTTGAAGGAG
GAAAAGGGAACGAAGGAACGCTCAGACGAGGACATGAAGCAAGAGAAGTCGAAAGATGCAAATCAACTACACAAT
GATCAACCTGCCATCTCGCTGAACGAAGAGGATCTACCTGTTCCTACCTATCATGCCTTACCACCCTCACCACCC
CGTCTACCACCTCGTAGGTCTGAACCCGTGAATGGAAGTCGGGACATAGAGAAAACAAAGAGTCTTAGTAGTGAT
AATGGCTCGGAGGTTAGTGAAGAGGGAGAAGCGGTATACATCGGTGATAGTACATGGGAGGAAAAGACGTGGAAA
GAATTGACAAAACTCCGCGAAGGAATGTACTGGGCGAGGATTGGCGCTGTTCGAGTATAA
Gene >Agabi119p4|111370
ATGGCAGAAGATATTCTAGATACTCATGACCCGTCTTCAGATCAGAACGGTCCGGGGAACAATCTCCGCAATGGC
AAGACCAATCATTACGCAGCCGATCCCGAAGCTCAGGAGATGGTCATTGAGTCTTTGCGAGGTCAAATTCAGGAC
CTCTTCTCCCAAGTGACGCAACTTAATTCCAAACTTGTCAAGTCTTATGATCGTGTTTCTGACTTAGAGGACAAT
CTCCATGTCACCTCTGCTCAGCTACGGACTTCATCCGTTAAAGTTTCTCAGCTTGAGCTCGAAAGGACACAGCAC
CTTGCCGCTTTGAATACTGGGTTACTAGTCGAGAAGCACCATGTCACTACTGAGCTAAATCGGCTTATGGAAAAG
GCAACGGAAGAGGCCGCGCATCGAGGACAAGCCGAGAGTGCTCGCGCCGCCATTGAAAAGGATCTTGATGACCTC
AGTGCCTCCTTGTTCAACCAGGCGAACACCATGGTGGCCGAGGCACGCTATGCGAAGCACCTCAGTGAAAGGAAA
GCTGTAGATGCCGAGCAGGCCCTCAAGAGCGCAGAGGAAGCCGTCAGCGCAATGCAGCAGCAGGTTCAAAATTTG
CAGGAAGACAAAGAGACCGCAGAACAGAAGGTTGAAGAAATGCAGACCCTCATCGGCTTGGGTGAAGATAATTGG
GTTGCCACAAAGAATCTCGAACCTCTCCCTCCTTCTCTTCGTCTTCTTGGTTCCCACCTTCCCTACCAAGAATTC
CTTTCCTTTGTCGCTCATCTTCGACAGCTCCACGTGAGCTCTTCAAACTATCCAGCGATGGCTACCCTTCTTTCT
CTGCCCTTTCTGACGCGGTTATCAACTGAAGACTCGTGAGCCATGAATCTTGTCGTTTTCATGATTCGGTCGCTG
ATGCTTATGTTCTTTTTAGAGAACCCACCTTACGACTAGACCTCGCACCGTCGTTGAGCTGGTTATCCAGGCGTT
CCGTTTTTGCTGCTATACATACTGGACAGCTCACCATTGAACCGGTGTCTTTCGCGACTTTGATTGCTGAATCGC
CTCAGTTATCGAATACAGGAATTTCTGCTGCTCATAACGAGAATATTCCGTGTGCTCTTTGTGGGACACCCATCT
TTCCTCAGGCCCCGTCGGCAAACACGGGTTCAACCCGACCTCCTTCTAATCCTCTCATAGGTATGGGGCACTCTT
ATTCCGGGTCTATCGGGTCTGCGTCTTCATGGTCCACCAACCTATTCAAGAAAAACCCCGCTCACTCAACCCCGC
CTCCCGCCTACTCAAGTTTTAATCCTCGTACCAGTCAAGCTTCATCCACACCTATGTATCCATCTCAAGTCTATA
TCTTCCGCATCTCATCAAATCAAGTATCGTCCAATCTACCCAGCCTACAATTGCTCAAATCATCAGCCCCTACAA
CTACTGTGTCTGGTTCACCGACGCCCTCCTCATTTGCATATACTCCACCCTTGTCCCACGGTCACTCGGCTGGAG
GAACACCTACTCAATCAAGTAGCACGATATATCCGCTTTGCACGAGTGGCTGGTGTCTCGCCCGTCTTCGCTCTA
CATGTTCATTATGGGCCTTTGTCCGAACTGGCATTGTAGAGAAAATCTGGGAAGAGGAAATTTCTAACATCACCA
ACCCTAAGCAAAGACCATCATCTAGAAGGGCATCCGTATCACATACTCAAGTTGCTGGCGCATCTGGTGCTGAAA
AATCTTCTGTGCCTCCAAAGAGGAGGGGCTTGTGGGGCTTTGCTAGCGCTATCGGAGCGAGCTGGAGTGATAGCG
CGAATGACAAGGATAAGGCGAGAAAACCACCCAGTTCTTCTGGGACACCAGAGAAGGAAATTGACGAAAAGAAAG
AAGTGAAACCGAGGACATTGCCTCCCCCACCACCTCGGCATCCCCGGGAGCTTGGAAGTAGTACGCCTCCCCCTC
TCCCCAAGCGTAGCGAAGGCCGGGTTCGAACTCCAGTACCTTCCTCCACGCCAGAGCCCATAGCCACTCCAGAGA
CAACAACTCAGTCTACCCAACTAGATGAAAGCAATATTTCCGATGCTAACGTGTCTACTACGGTTCAGAATGAAA
AGCACGCTGCCTCACCAGAACTTTCTTCTCCATTTCCAGCCGTCAGTGGCGCACCAACTTCCCCAATTTCCCCGA
ATCGAACACAGCGTCCCATGACTCCGTCGACACCACCACCACCAATTCCTCCTCGTGCCGCCAAAAGACTCTCGG
CATCAGTCGTTCGACCTGGTACACCTTCTAGTATACCATTACCTGAGTCCCGTCCTGATACCCCTGTCATTGGTT
CTGGTGTTATACCCAACCCTCCATCCCGCACTGCCTCGCCCGCACTTGGAAGTTCGTCTGCGACTGATGCTCCTC
CACCTATTCCTAAACGTGCCGCTTCAAGAAGACGGCTTACCGGGGAAATCGATCCAAGGCCTGAATCGCCAGTGG
CACCTAGCTCTCCTGCCACAAAGCATGAAGGTCAAGCTCAGAGTGTAGCTGCTTTGACATCTTCATCTCAGACTC
AATTGGATACCGTAAAAGAGGCTGTTGAGGAAGCTAAAACAGAGAATCAAGATACCGAGACGATGGAGTTTACTG
AATCGCCGATAGCGGTAAAATCGGTTCCCAGTATTGCCTCAAACACTACAACTTCCGGGGAGGAGGTTTTCTTGG
ATGCTAACGATAGTTCTATGGCAGTGGAGGATGAGAAAGAGGATAAGGACAAAGAAGATAAAGCTGATAAGGAGA
AAGAGGACGAAGTCGAGAGGGAGAAAGAGGATGAAGCTGAGGTCAAGACGTTGAAGGAGGAAAAGGGAACGAAGG
AACGCTCAGACGAGGACATGAAGCAAGAGAAGTCGAAAGATGCAAATCAACTACACAATGATCAACCTGCCATCT
CGCTGAACGAAGAGGATCTACCTGTTCCTACCTATCATGCCTTACCACCCTCACCACCCCGTCTACCACCTCGTA
GGTCTGAACCCGTGAATGGAAGTCGGGACATAGAGAAAACAAAGAGTCTTAGTAGTGATAATGGCTCGGAGGTTA
GTGAAGAGGGAGAAGCGGTATACATCGGTGATAGTACATGGGAGGAAAAGACGTGGAAAGAATTGACAAAACTCC
GCGAAGGAATGTACTGGGCGAGGATTGGCGCTGTTCGAGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail