Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|111110
Gene name
Locationscaffold_08:1190216..1193504
Strand+
Gene length (bp)3288
Transcript length (bp)2541
Coding sequence length (bp)2541
Protein length (aa) 847

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04840 Vps16_C Vps16, C-terminal region 1.4E-86 523 831
PF04841 Vps16_N Vps16, N-terminal region 6.6E-84 5 415

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55C58|VPS16_DICDI Vacuolar protein sorting-associated protein 16 homolog OS=Dictyostelium discoideum GN=vps16 PE=3 SV=2 15 846 9.0E-163
sp|Q9UT38|VPS16_SCHPO Probable vacuolar protein sorting-associated protein 16 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps16 PE=3 SV=1 3 841 3.0E-141
sp|Q93VQ0|VCL1_ARATH Protein VACUOLELESS1 OS=Arabidopsis thaliana GN=VCL1 PE=1 SV=1 9 805 3.0E-141
sp|Q920Q4|VPS16_MOUSE Vacuolar protein sorting-associated protein 16 homolog OS=Mus musculus GN=Vps16 PE=1 SV=3 6 832 2.0E-136
sp|Q5E9L7|VPS16_BOVIN Vacuolar protein sorting-associated protein 16 homolog OS=Bos taurus GN=VPS16 PE=2 SV=1 6 829 3.0E-134
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55C58|VPS16_DICDI Vacuolar protein sorting-associated protein 16 homolog OS=Dictyostelium discoideum GN=vps16 PE=3 SV=2 15 846 9.0E-163
sp|Q9UT38|VPS16_SCHPO Probable vacuolar protein sorting-associated protein 16 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps16 PE=3 SV=1 3 841 3.0E-141
sp|Q93VQ0|VCL1_ARATH Protein VACUOLELESS1 OS=Arabidopsis thaliana GN=VCL1 PE=1 SV=1 9 805 3.0E-141
sp|Q920Q4|VPS16_MOUSE Vacuolar protein sorting-associated protein 16 homolog OS=Mus musculus GN=Vps16 PE=1 SV=3 6 832 2.0E-136
sp|Q5E9L7|VPS16_BOVIN Vacuolar protein sorting-associated protein 16 homolog OS=Bos taurus GN=VPS16 PE=2 SV=1 6 829 3.0E-134
sp|Q9H269|VPS16_HUMAN Vacuolar protein sorting-associated protein 16 homolog OS=Homo sapiens GN=VPS16 PE=1 SV=2 6 829 6.0E-134
sp|Q03308|VPS16_YEAST Vacuolar protein sorting-associated protein 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS16 PE=1 SV=2 273 812 3.0E-56
sp|Q11182|VPS16_CAEEL Vacuolar protein sorting-associated protein 16 homolog OS=Caenorhabditis elegans GN=vps-16 PE=3 SV=2 15 840 6.0E-35
sp|Q60V75|VPS16_CAEBR Vacuolar protein sorting-associated protein 16 homolog OS=Caenorhabditis briggsae GN=vps-16 PE=3 SV=1 15 792 7.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0006886 intracellular protein transport Yes
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0033036 macromolecule localization No
GO:0051641 cellular localization No
GO:0015031 protein transport No
GO:0071705 nitrogen compound transport No
GO:0046907 intracellular transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0051179 localization No
GO:0051649 establishment of localization in cell No
GO:0045184 establishment of protein localization No
GO:0071702 organic substance transport No
GO:0051234 establishment of localization No
GO:0070727 cellular macromolecule localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|111110
MEEHPTTSWQAMQEGNVFYRRQRLYNVSGRLPDLSDYIIAGCRYGGPIALMRDTSKIVTFNRSVPAMSKSQVQVY
SLAGEPVLSLSWDRAKIVRFGWTLDERLVLLNEEGVYRIYDLQGEYQQYSLGTEAAELGVLDARIHDNGLVALTN
NYTLLEVKDWDGGRSLTLANTGLTEPPHAWTIIPPDLNISRHVEVLLSVEATIYTVDNLESVDQRINKGPFTHIS
PSPNGKLLALVTFSGMLWVVSTDFQRSMIEFDTNNVVGAEGSVKQVEWCGNDAILLTWEGLAVLVGPPGDILQYF
YTGPLFAVTEMDGVRVIGPEVCDFLQKVPASTLSIFRPGSTSSSAILFDAWESFTNRSPKADESIRSIKPELAKA
VDECIEAAGQEWEPYWQRRLLNAAKFGRGYLDFHNPTDFVNMGQTLKVLNAVRYYEIGIPLTYLEYNYASPSHLI
TRLTSRNLHLVALRISSFLNLKPDLVLMHWACAKIARTRPSATGAGKDTELDGDDEICAAIVEKFVQVGSIDVSY
ADIAKRAWELGRTGLATKLLDHETRASDQVPLLLKMKEDRLALNKAVNSGDTDMVYYVLLDLHKRLPLGSFFQLI
EEGGNRIAPASRLLQVYAREQDREMLRDFYYSDDRRVESATLSLEEASSATDQAAKLSFVKSAQKFFSEDKDRAF
EAKTMDDSARLLTFQQQLEKEADGKISFFGLSVNETIRECIVNGMSKRAEKIRSDFKVPDRRFWYLKLHALTEIK
DFEGLDAFSRTKRSPIGYESFVRHLVEKGHAKEAVMYVGRCDSPKRVDLYVECGEWRLAGKECKERGDKVKLEEI
RKKCPNSLILRELDQIASSMK*
Coding >Agabi119p4|111110
ATGGAGGAACACCCGACCACGTCATGGCAGGCTATGCAGGAAGGCAATGTCTTTTATCGTCGGCAGCGCCTATAC
AACGTCTCTGGCAGGTTGCCCGACCTCAGCGACTATATCATTGCGGGATGTCGGTATGGTGGTCCCATAGCACTT
ATGCGCGATACTAGCAAGATCGTAACCTTCAATCGCTCCGTTCCCGCAATGTCCAAATCACAAGTACAAGTCTAC
TCGCTTGCAGGCGAGCCAGTTCTTTCCCTTAGTTGGGATAGAGCGAAAATTGTACGCTTTGGCTGGACATTGGAT
GAACGGCTCGTGTTGTTGAATGAAGAAGGCGTGTATCGCATATATGATCTTCAAGGCGAATATCAGCAATATTCG
TTAGGGACTGAAGCTGCTGAACTGGGTGTCCTTGACGCGCGGATACACGATAACGGGCTCGTTGCGCTGACTAAC
AACTATACTCTGTTAGAGGTCAAGGATTGGGATGGAGGACGATCGTTGACGTTGGCCAATACAGGTCTCACTGAA
CCGCCACATGCATGGACTATCATTCCTCCAGATCTTAACATCTCGCGACACGTTGAAGTTTTACTCTCAGTCGAG
GCCACCATTTATACTGTGGACAATCTTGAAAGTGTTGATCAACGTATCAACAAGGGGCCTTTTACACATATATCC
CCTTCACCGAATGGCAAACTTCTTGCATTGGTTACTTTCTCTGGAATGTTATGGGTTGTTTCAACGGATTTTCAA
CGCAGCATGATTGAATTCGATACAAACAATGTTGTTGGTGCTGAAGGATCTGTGAAACAAGTCGAATGGTGTGGT
AATGACGCTATTCTGCTGACCTGGGAGGGTCTTGCTGTCTTAGTAGGACCCCCTGGCGATATTCTACAATATTTC
TACACCGGCCCTCTGTTTGCTGTAACTGAAATGGACGGTGTTCGTGTAATAGGACCCGAGGTTTGCGATTTTCTT
CAAAAAGTGCCAGCTTCTACCCTGTCCATCTTTCGACCAGGATCGACCTCCTCTTCGGCAATACTCTTCGATGCT
TGGGAGAGTTTCACCAATCGTTCGCCGAAAGCGGACGAAAGTATCCGTAGCATCAAGCCTGAGCTCGCGAAAGCG
GTTGATGAGTGCATCGAAGCAGCCGGTCAAGAATGGGAACCTTATTGGCAACGTCGACTTCTCAATGCAGCCAAA
TTTGGGCGCGGTTATTTGGATTTCCACAATCCTACAGATTTTGTCAACATGGGTCAAACTTTGAAAGTGTTAAAC
GCTGTTCGCTATTATGAAATAGGCATACCGCTTACATACTTGGAATACAACTACGCTTCTCCTTCTCATCTCATA
ACACGACTTACGTCTCGGAACCTCCACCTTGTGGCTTTGCGTATATCTTCCTTCTTGAACCTGAAACCTGACCTT
GTGTTGATGCATTGGGCATGTGCCAAGATTGCGCGAACACGTCCGTCAGCTACGGGTGCAGGGAAGGATACCGAG
TTGGATGGTGATGATGAAATTTGTGCAGCAATTGTTGAGAAATTCGTGCAGGTGGGAAGTATAGACGTGAGCTAT
GCGGATATTGCGAAGCGCGCATGGGAGCTTGGTCGTACAGGCCTTGCTACGAAACTGCTTGACCATGAAACTAGG
GCTTCTGATCAGGTTCCCCTGCTATTGAAAATGAAGGAAGACCGTCTAGCATTGAACAAAGCCGTGAATAGTGGT
GATACGGATATGGTCTACTACGTATTGCTTGACTTGCACAAAAGACTTCCCTTGGGGTCATTCTTTCAGTTGATT
GAAGAGGGCGGTAATCGAATTGCGCCAGCTAGTAGATTACTTCAAGTTTATGCACGAGAGCAGGACCGGGAAATG
CTCAGGGACTTCTATTATTCGGATGATAGAAGGGTGGAGAGTGCGACACTATCTCTTGAAGAGGCTTCAAGTGCG
ACTGATCAGGCGGCGAAGCTGTCATTTGTCAAATCGGCACAGAAGTTCTTCTCGGAAGATAAAGATCGTGCTTTT
GAGGCTAAGACGATGGATGACAGCGCTCGCCTCTTAACATTTCAGCAACAGCTCGAGAAGGAGGCCGACGGAAAG
ATTTCATTCTTTGGGTTAAGTGTGAATGAAACGATTAGGGAATGCATCGTCAATGGAATGTCTAAACGAGCTGAG
AAGATCAGGTCAGACTTCAAGGTCCCAGATAGACGTTTCTGGTATCTCAAATTACACGCGTTGACAGAAATCAAG
GACTTTGAAGGGTTAGACGCTTTTTCAAGAACGAAGAGAAGTCCAATAGGTTATGAATCATTTGTACGGCATCTT
GTGGAGAAGGGTCATGCGAAAGAAGCTGTCATGTATGTTGGTCGTTGCGATTCACCAAAGAGGGTCGATTTGTAT
GTGGAATGCGGGGAATGGCGGTTGGCTGGGAAGGAATGTAAAGAGCGCGGAGATAAGGTCAAATTGGAGGAGATT
CGGAAAAAATGTCCTAATTCTTTGATCTTACGTGAATTAGATCAGATCGCTTCTAGCATGAAATAA
Transcript >Agabi119p4|111110
ATGGAGGAACACCCGACCACGTCATGGCAGGCTATGCAGGAAGGCAATGTCTTTTATCGTCGGCAGCGCCTATAC
AACGTCTCTGGCAGGTTGCCCGACCTCAGCGACTATATCATTGCGGGATGTCGGTATGGTGGTCCCATAGCACTT
ATGCGCGATACTAGCAAGATCGTAACCTTCAATCGCTCCGTTCCCGCAATGTCCAAATCACAAGTACAAGTCTAC
TCGCTTGCAGGCGAGCCAGTTCTTTCCCTTAGTTGGGATAGAGCGAAAATTGTACGCTTTGGCTGGACATTGGAT
GAACGGCTCGTGTTGTTGAATGAAGAAGGCGTGTATCGCATATATGATCTTCAAGGCGAATATCAGCAATATTCG
TTAGGGACTGAAGCTGCTGAACTGGGTGTCCTTGACGCGCGGATACACGATAACGGGCTCGTTGCGCTGACTAAC
AACTATACTCTGTTAGAGGTCAAGGATTGGGATGGAGGACGATCGTTGACGTTGGCCAATACAGGTCTCACTGAA
CCGCCACATGCATGGACTATCATTCCTCCAGATCTTAACATCTCGCGACACGTTGAAGTTTTACTCTCAGTCGAG
GCCACCATTTATACTGTGGACAATCTTGAAAGTGTTGATCAACGTATCAACAAGGGGCCTTTTACACATATATCC
CCTTCACCGAATGGCAAACTTCTTGCATTGGTTACTTTCTCTGGAATGTTATGGGTTGTTTCAACGGATTTTCAA
CGCAGCATGATTGAATTCGATACAAACAATGTTGTTGGTGCTGAAGGATCTGTGAAACAAGTCGAATGGTGTGGT
AATGACGCTATTCTGCTGACCTGGGAGGGTCTTGCTGTCTTAGTAGGACCCCCTGGCGATATTCTACAATATTTC
TACACCGGCCCTCTGTTTGCTGTAACTGAAATGGACGGTGTTCGTGTAATAGGACCCGAGGTTTGCGATTTTCTT
CAAAAAGTGCCAGCTTCTACCCTGTCCATCTTTCGACCAGGATCGACCTCCTCTTCGGCAATACTCTTCGATGCT
TGGGAGAGTTTCACCAATCGTTCGCCGAAAGCGGACGAAAGTATCCGTAGCATCAAGCCTGAGCTCGCGAAAGCG
GTTGATGAGTGCATCGAAGCAGCCGGTCAAGAATGGGAACCTTATTGGCAACGTCGACTTCTCAATGCAGCCAAA
TTTGGGCGCGGTTATTTGGATTTCCACAATCCTACAGATTTTGTCAACATGGGTCAAACTTTGAAAGTGTTAAAC
GCTGTTCGCTATTATGAAATAGGCATACCGCTTACATACTTGGAATACAACTACGCTTCTCCTTCTCATCTCATA
ACACGACTTACGTCTCGGAACCTCCACCTTGTGGCTTTGCGTATATCTTCCTTCTTGAACCTGAAACCTGACCTT
GTGTTGATGCATTGGGCATGTGCCAAGATTGCGCGAACACGTCCGTCAGCTACGGGTGCAGGGAAGGATACCGAG
TTGGATGGTGATGATGAAATTTGTGCAGCAATTGTTGAGAAATTCGTGCAGGTGGGAAGTATAGACGTGAGCTAT
GCGGATATTGCGAAGCGCGCATGGGAGCTTGGTCGTACAGGCCTTGCTACGAAACTGCTTGACCATGAAACTAGG
GCTTCTGATCAGGTTCCCCTGCTATTGAAAATGAAGGAAGACCGTCTAGCATTGAACAAAGCCGTGAATAGTGGT
GATACGGATATGGTCTACTACGTATTGCTTGACTTGCACAAAAGACTTCCCTTGGGGTCATTCTTTCAGTTGATT
GAAGAGGGCGGTAATCGAATTGCGCCAGCTAGTAGATTACTTCAAGTTTATGCACGAGAGCAGGACCGGGAAATG
CTCAGGGACTTCTATTATTCGGATGATAGAAGGGTGGAGAGTGCGACACTATCTCTTGAAGAGGCTTCAAGTGCG
ACTGATCAGGCGGCGAAGCTGTCATTTGTCAAATCGGCACAGAAGTTCTTCTCGGAAGATAAAGATCGTGCTTTT
GAGGCTAAGACGATGGATGACAGCGCTCGCCTCTTAACATTTCAGCAACAGCTCGAGAAGGAGGCCGACGGAAAG
ATTTCATTCTTTGGGTTAAGTGTGAATGAAACGATTAGGGAATGCATCGTCAATGGAATGTCTAAACGAGCTGAG
AAGATCAGGTCAGACTTCAAGGTCCCAGATAGACGTTTCTGGTATCTCAAATTACACGCGTTGACAGAAATCAAG
GACTTTGAAGGGTTAGACGCTTTTTCAAGAACGAAGAGAAGTCCAATAGGTTATGAATCATTTGTACGGCATCTT
GTGGAGAAGGGTCATGCGAAAGAAGCTGTCATGTATGTTGGTCGTTGCGATTCACCAAAGAGGGTCGATTTGTAT
GTGGAATGCGGGGAATGGCGGTTGGCTGGGAAGGAATGTAAAGAGCGCGGAGATAAGGTCAAATTGGAGGAGATT
CGGAAAAAATGTCCTAATTCTTTGATCTTACGTGAATTAGATCAGATCGCTTCTAGCATGAAATAA
Gene >Agabi119p4|111110
ATGGAGGAACACCCGACCACGTCATGGCAGGCTATGCAGGAAGGCAATGTCTTTTATCGTCGGCAGCGCCTATAC
AACGTCTCTGGCAGGTTGCCCGACCTCAGCGACTATATCATTGCGGGATGTCGGTATGGTGGTCCCATAGGTATG
GATCCTGGGTACTTTCTTCATCCCTTTGGATGCTAATGCTTTCATAGCACTTATGCGCGATACTAGCAAGATCGT
AACCTTCAATCGCTCCGTTCCCGCAATGTCCAAATCACAAGTACAAGTCTACTCGCTTGCAGGCGAGCCAGTTCT
TTCCCTTAGTGTGGATTTTCTCTGTTGTCACCGCGTTTCAATGATGCTAATTCATGACATTTTAGTGGGATAGAG
CGAAAATTGTACGCTTTGGCTGGACATTGGATGAACGGCTCGTGTTGTTGAATGAAGAAGGCGTGTATCGCATAT
ATGATCTTCAAGGCGAATATCAGCAATATTCGTTAGGGACTGAAGCTGCTGAACTGGGTGTCCTTGACGCGCGGA
TACACGATAACGGGCTCGTTGCGCTGACTAACAACTATACTCTGTTAGAGGTCAAGGATTGGGATGGAGGACGAT
CGTTGACGTTGGCCAATACAGGTAAGTCCTTGATACGAATATAATATGGCTTAACATGATTTTGATTTTGATTTC
GAGGTCTCACTGAACCGCCACATGCATGGACTATCATTCCTCCAGATCTTAACATCTCGCGACACGTTGAAGTTT
TACTCTCAGTCGAGGCCACCATTTATACTGTGGACAATCTTGAAAGTGTTGATCAACGTATCAACAAGGGGCCTT
TTACACATATATCCCCTTCACCGAATGGCAAACTTCTTGCATTGGTTACTTTCTCTGGAATGTTATGGGTTGTTT
CAACGGATTTTCAACGCAGCATGATTGAATTCGATACAAACAATGTTGTTGGTGCTGAAGGATCTGTGAAACAAG
TCGAATGGTGTGGTAATGACGCTATTCTGCTGACCTGGGAGGGTCTTGCTGTCTTAGTAGGACCCCCTGGCGATA
TTCTACAGTACGTAGCTGCCCTCTGCATATACCGCAAATATCTATTCTCATGTTTGTGATACAGATATTTCTACA
CCGGCCCTCTGTTTGCTGTAACTGAAATGGACGGTGTTCGTGTAATAGGACCCGAGGTTTGCGATTTTCTTCAAA
AAGTGCCAGGTAGATGGCCCACTCCTCCTTTGACTATATCATCTTCTGAGCGATTATAGCTTCTACCCTGTCCAT
CTTTCGACCAGGATCGACCTCCTCTTCGGCAATACTCTTCGATGCTTGGGAGAGTTTCACCAATCGTTCGCCGAA
AGCGGACGAAAGTATCCGTAGCATCAAGCCTGAGCTCGCGAAAGCGGTTGATGAGTGCATCGAAGCAGCCGGTCA
AGAATGGGAACCTTATTGGCAACGTCGACTTCTCAATGTCCGTGTTTATGCCGTCTGCTATTTTATTGGCGTACT
TATTGACCGGTTTGTATAGGCAGCCAAATTTGGGCGCGGTTATTTGGATTTCCACAATCCTACAGATTTTGTCAA
CATGGGTCAAACTTTGAAAGTGTTAAACGCTGTTCGCTATTATGAAATAGGCATACCGCTTACATACTTGGAGTA
GGTTTGCGAAAATTCTTTCGTAGAGCCGCAGCTAATGCCTTGTTAGATACAACTACGCTTCTCCTTCTCATCTCA
TAACACGACTTACGTCTCGGAACCTCCACCTTGTGGCTTTGCGTATATCTTCCTTCTTGAACCTGAAACCTGACC
TTGTGTTGATGCATTGGGCATGTGCCAAGATTGCGCGAACACGTCCGTCAGCTACGGGTGCAGGGAAGGATACCG
AGTTGGATGGTGATGATGAAATTTGTGCAGCAATTGTTGAGAAATTCGTGCAGGTGGGAAGTATAGACGTGAGCT
ATGCGGATATTGCGAAGCGCGCATGGGAGCTTGGTCGTACAGGCCTTGCTACGAAAGTTTGAATATTCATTTGCA
CTCAGTGGTCACTTTTCTGACTTTGACTGAACAGCTGCTTGACCATGAAACTAGGGCTTCTGATCAGGTTCCCCT
GCTATTGAAAATGAAGGAAGACCGTCTAGCATTGAACAAAGCCGTGAATAGTGGTGATACGGATATGGGTGGGTT
CTTCTTTTGATCTGTCCTTCCACTTGCTGACGTAGATACAAGTCTACTACGTATTGCTTGACTTGCACAAAAGAC
TTCCCTTGGGGTCATTCTTTCAGTTGATTGAAGAGGGCGGTAATCGAATTGCGCCAGCTAGTAGATTACTTCAAG
TTTATGCACGAGAGCAGGACCGGGAAATGCTCAGGGACTTCTATTATTCGGATGATAGAAGGGTGGAGAGTGCGA
CACTATCTCTTGAAGAGGCTTCAAGTGCGACTGTGAGCCTGGCTTTCTTCGTTCTTCATTTAAATCGCTTAATCT
CGTCACTTTTCCAGGATCAGGCGGCGAAGCTGTCATTTGTCAAATCGGCACAGAAGTTCTTCTCGGAAGATAAAG
ATCGTGCTTTTGAGGCTAAGGTATGGCATACAAGTGAAATGCTTCATCGGTTGGCATTGCTTAGTTGATATGCTG
TTTTAGACGATGGATGACAGCGCTCGCCTCTTAACATTTCAGCAACAGCTCGAGAAGGAGGCCGACGGAAAGATT
TCATTCTTTGGGTTAAGTGTGAATGAAACGATTAGGGAATGCATCGTCAATGGAATGTCTAAACGAGCTGAGAAG
ATCAGGTCAGACTTCAAGGTCCCAGATAGACGGTAAAGTCTTCCAACGCCAGTTCACCAAAAGGAATGACACTCA
AAAACTTTTTTTCCTTTTTCTCTTATCGCCTATTCAGTTTCTGGTATCTCAAATTACACGCGTTGACAGAAATCA
AGGACTTTGAAGGGTTAGACGCTTTTTCAAGAACGAAGAGAAGTCCAATAGGTTATGAATCATTTGTACGGCATC
TTGTGGAGAAGGGTCATGCGAAAGAAGCTGTCATGTATGTTGGTCGTTGCGATTCACCAAAGAGGGTCGATTTGT
ATGTGGAATGCGGGGAATGGCGGTTGGCTGGGAAGGAATGTAAAGAGCGCGGAGATAAGGTCAAATTGGAGTAAG
TCAAGCCTGGTGGCAGGGTCTTTTCGATTGGGATCACGGATGTTAACAATTACTTCTTTTAACAGGGAGATTCGG
AAAAAATGTCCTAATTCTTTGATCTTACGTGAATTAGATCAGATCGCTTCTAGCATGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail