Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|110500
Gene name
Locationscaffold_08:1003671..1004984
Strand+
Gene length (bp)1313
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.9E-29 23 255
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.3E-21 28 310

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 15 313 2.0E-17
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 15 313 2.0E-17
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 17 310 8.0E-16
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 9 311 1.0E-14
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 17 310 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 15 313 2.0E-17
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 15 313 2.0E-17
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 17 310 8.0E-16
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 9 311 1.0E-14
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 17 310 3.0E-14
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 9 311 5.0E-14
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 19 313 6.0E-14
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 23 311 9.0E-14
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 23 311 2.0E-13
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 1 310 5.0E-13
sp|O70351|HCD2_RAT 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3 19 309 1.0E-12
sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 19 309 1.0E-12
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 24 312 2.0E-12
sp|O08756|HCD2_MOUSE 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus GN=Hsd17b10 PE=1 SV=4 19 309 3.0E-12
sp|Q42182|TRNH7_ARATH Tropinone reductase homolog At2g29300 OS=Arabidopsis thaliana GN=At2g29300 PE=2 SV=2 17 310 4.0E-12
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 10 312 6.0E-12
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 19 279 2.0E-11
sp|O02691|HCD2_BOVIN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 19 309 3.0E-11
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 23 311 3.0E-11
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 24 252 6.0E-11
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 24 252 6.0E-11
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 24 252 6.0E-11
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 17 310 6.0E-11
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 23 310 1.0E-10
sp|Q9ZW14|TRNH8_ARATH Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1 17 310 1.0E-10
sp|Q9ZW15|TRNH9_ARATH Tropinone reductase homolog At2g29320 OS=Arabidopsis thaliana GN=At2g29320 PE=2 SV=1 14 310 2.0E-10
sp|Q8RX32|TRNH2_ARATH Tropinone reductase homolog At1g07450 OS=Arabidopsis thaliana GN=At1g07450 PE=2 SV=1 15 310 2.0E-10
sp|Q9ZW16|TRNHA_ARATH Tropinone reductase homolog At2g29330 OS=Arabidopsis thaliana GN=TRI PE=1 SV=1 17 310 3.0E-10
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 16 250 4.0E-10
sp|P9WGQ7|Y1144_MYCTU Uncharacterized oxidoreductase Rv1144 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1144 PE=1 SV=1 23 309 6.0E-10
sp|P9WGQ6|Y1144_MYCTO Uncharacterized oxidoreductase MT1177 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1177 PE=3 SV=1 23 309 6.0E-10
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 19 246 9.0E-10
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 19 316 1.0E-09
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 23 314 1.0E-09
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 10 310 2.0E-09
sp|P50206|BPHB_PSES1 Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas sp. (strain KKS102) GN=bphB PE=3 SV=1 23 279 2.0E-09
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 19 313 2.0E-09
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 23 310 2.0E-09
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 8 313 2.0E-09
sp|Q13268|DHRS2_HUMAN Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 17 309 2.0E-09
sp|Q9LTV6|DECR2_ARATH Peroxisomal 2,4-dienoyl-CoA reductase OS=Arabidopsis thaliana GN=At3g12800 PE=2 SV=1 19 316 2.0E-09
sp|P47227|BPHB_BURXL Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=bphB PE=1 SV=1 19 279 3.0E-09
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 17 310 3.0E-09
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 25 285 6.0E-09
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 17 310 6.0E-09
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 18 255 6.0E-09
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 19 316 7.0E-09
sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 19 310 8.0E-09
sp|P72220|BPHB_PSEPU Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 19 279 1.0E-08
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 18 169 1.0E-08
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 19 263 1.0E-08
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 17 312 1.0E-08
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 19 247 2.0E-08
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 19 247 2.0E-08
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 20 311 2.0E-08
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 19 315 2.0E-08
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 16 311 3.0E-08
sp|Q99L04|DHRS1_MOUSE Dehydrogenase/reductase SDR family member 1 OS=Mus musculus GN=Dhrs1 PE=1 SV=1 19 252 3.0E-08
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 19 310 4.0E-08
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 17 312 5.0E-08
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 21 250 6.0E-08
sp|Q9HK58|RHAD_THEAC L-rhamnose 1-dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rhaD PE=1 SV=2 16 313 6.0E-08
sp|O34896|UXUB_BACSU Uncharacterized oxidoreductase UxuB OS=Bacillus subtilis (strain 168) GN=uxuB PE=2 SV=1 18 310 6.0E-08
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 19 312 6.0E-08
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 19 247 6.0E-08
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 19 310 6.0E-08
sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 19 310 8.0E-08
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 19 247 8.0E-08
sp|Q7FAE1|MOMAS_ORYSJ Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1 21 317 1.0E-07
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 19 247 1.0E-07
sp|P05406|FIXR_BRADU Protein FixR OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixR PE=3 SV=2 23 313 1.0E-07
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 19 246 1.0E-07
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 23 252 2.0E-07
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 23 310 2.0E-07
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 23 310 2.0E-07
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 23 310 2.0E-07
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 23 310 2.0E-07
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 23 310 2.0E-07
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 23 310 2.0E-07
sp|P08694|BPHB_PSEPS Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas pseudoalcaligenes GN=bphB PE=3 SV=2 19 279 2.0E-07
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 19 313 2.0E-07
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 19 313 2.0E-07
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 19 313 2.0E-07
sp|P0C622|CMTB_PSEPU 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida GN=cmtB PE=3 SV=1 14 314 2.0E-07
sp|A5W4G5|CMTB_PSEP1 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cmtB PE=3 SV=1 14 314 2.0E-07
sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 19 313 2.0E-07
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 23 254 2.0E-07
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 24 252 3.0E-07
sp|Q51576|Y3106_PSEAE Uncharacterized oxidoreductase PA3106 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3106 PE=3 SV=1 21 310 3.0E-07
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 10 310 3.0E-07
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 14 310 3.0E-07
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 23 309 4.0E-07
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 19 246 4.0E-07
sp|P50200|HDHA_CLOSO NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 23 317 5.0E-07
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 23 313 7.0E-07
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 19 313 8.0E-07
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 23 254 1.0E-06
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 23 254 1.0E-06
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 23 254 1.0E-06
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 15 254 1.0E-06
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 23 254 1.0E-06
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 23 254 1.0E-06
sp|Q9ZW19|TRNHC_ARATH Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 17 310 1.0E-06
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 23 310 2.0E-06
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 21 252 2.0E-06
sp|Q92506|DHB8_HUMAN Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2 19 252 2.0E-06
sp|P13859|TODD_PSEP1 Cis-toluene dihydrodiol dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todD PE=1 SV=1 19 246 2.0E-06
sp|P08088|BNZE_PSEPU Cis-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Pseudomonas putida GN=bnzE PE=3 SV=2 19 246 2.0E-06
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 19 136 2.0E-06
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 21 313 2.0E-06
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 17 310 2.0E-06
sp|O16881|DHS16_CAEEL 3 beta-hydroxysteroid dehydrogenase dhs-16 OS=Caenorhabditis elegans GN=dhs-16 PE=2 SV=1 7 252 3.0E-06
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 17 310 3.0E-06
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 19 313 3.0E-06
sp|Q23116|YWC4_CAEEL Uncharacterized oxidoreductase W01C9.4 OS=Caenorhabditis elegans GN=W01C9.4 PE=3 SV=1 20 310 4.0E-06
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 19 313 4.0E-06
sp|Q05528|KDUD_DICD3 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 13 312 4.0E-06
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 18 317 4.0E-06
sp|P50167|ARDH_PICST D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARDH PE=2 SV=1 17 310 4.0E-06
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 24 252 4.0E-06
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 18 317 6.0E-06
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 17 249 6.0E-06
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 19 309 6.0E-06
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 18 317 6.0E-06
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 23 252 7.0E-06
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 17 310 7.0E-06
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 19 310 8.0E-06
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 23 254 8.0E-06
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 23 254 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|110500
MTDTKSILNGLTVQNLFDMRGVVAVVTGGASGIGLMISSTLMANGAKVYVVDKEQERIERVPKRYNESATPQMGS
LIGIQADISQKSEATRLANHISSLEPNGITALFNNAGISTGAFKRPDPKTNPTAQDFVKALFDDVPEHTFTDTYK
VNAVGPYWLTFAFLPLLEKRKLYQEANAEKIEANGGRGYVPSIIMTSSMNGWTKDLATAAYSYPYSFSKSAIGTG
TAALAHELLPLGIRVNGIAPGLFPSEMASPGTSSSLGVSSTSGRDFPFVTPVNRDGGTRYDMGMLALFLISNWFV
NGETVLIDGGTLLVHPSAY*
Coding >Agabi119p4|110500
ATGACAGACACAAAATCCATTTTGAACGGGTTGACTGTGCAAAACCTGTTTGATATGCGAGGCGTGGTAGCTGTT
GTGACAGGTGGTGCTTCTGGCATTGGGCTTATGATAAGTTCGACACTTATGGCCAATGGGGCGAAGGTGTACGTA
GTTGATAAAGAACAGGAACGCATAGAAAGGGTTCCGAAAAGGTACAATGAGAGTGCTACACCTCAAATGGGTAGC
TTGATTGGTATTCAGGCGGATATCAGCCAAAAGTCGGAAGCAACTCGTCTAGCCAACCATATTTCCTCCCTCGAG
CCAAATGGGATAACTGCTTTATTCAACAACGCGGGTATATCCACGGGAGCTTTCAAACGCCCTGACCCGAAAACC
AATCCAACTGCACAAGACTTTGTCAAAGCATTATTCGATGATGTTCCCGAGCATACGTTTACGGATACATACAAA
GTCAACGCAGTGGGACCTTATTGGTTGACGTTTGCTTTTTTACCTTTACTTGAGAAACGCAAGTTGTATCAAGAG
GCTAATGCGGAAAAAATAGAAGCGAATGGTGGGAGAGGGTATGTGCCTTCGATTATTATGACTAGCAGTATGAAT
GGTTGGACAAAGGACCTCGCCACTGCAGCATATTCATACCCTTATTCATTTTCTAAATCTGCTATCGGCACGGGT
ACCGCTGCACTTGCACATGAATTGCTACCCCTCGGAATCAGGGTAAATGGTATCGCTCCGGGTTTATTCCCTTCA
GAGATGGCCTCGCCCGGAACTTCAAGTTCACTCGGGGTATCTAGCACATCCGGGAGAGACTTTCCTTTTGTCACA
CCTGTGAATAGGGATGGTGGCACGAGATATGACATGGGCATGCTCGCTTTATTTTTGATATCCAATTGGTTTGTC
AACGGCGAGACTGTCTTGATTGATGGGGGCACTCTACTTGTACACCCATCTGCATATTAA
Transcript >Agabi119p4|110500
ATGACAGACACAAAATCCATTTTGAACGGGTTGACTGTGCAAAACCTGTTTGATATGCGAGGCGTGGTAGCTGTT
GTGACAGGTGGTGCTTCTGGCATTGGGCTTATGATAAGTTCGACACTTATGGCCAATGGGGCGAAGGTGTACGTA
GTTGATAAAGAACAGGAACGCATAGAAAGGGTTCCGAAAAGGTACAATGAGAGTGCTACACCTCAAATGGGTAGC
TTGATTGGTATTCAGGCGGATATCAGCCAAAAGTCGGAAGCAACTCGTCTAGCCAACCATATTTCCTCCCTCGAG
CCAAATGGGATAACTGCTTTATTCAACAACGCGGGTATATCCACGGGAGCTTTCAAACGCCCTGACCCGAAAACC
AATCCAACTGCACAAGACTTTGTCAAAGCATTATTCGATGATGTTCCCGAGCATACGTTTACGGATACATACAAA
GTCAACGCAGTGGGACCTTATTGGTTGACGTTTGCTTTTTTACCTTTACTTGAGAAACGCAAGTTGTATCAAGAG
GCTAATGCGGAAAAAATAGAAGCGAATGGTGGGAGAGGGTATGTGCCTTCGATTATTATGACTAGCAGTATGAAT
GGTTGGACAAAGGACCTCGCCACTGCAGCATATTCATACCCTTATTCATTTTCTAAATCTGCTATCGGCACGGGT
ACCGCTGCACTTGCACATGAATTGCTACCCCTCGGAATCAGGGTAAATGGTATCGCTCCGGGTTTATTCCCTTCA
GAGATGGCCTCGCCCGGAACTTCAAGTTCACTCGGGGTATCTAGCACATCCGGGAGAGACTTTCCTTTTGTCACA
CCTGTGAATAGGGATGGTGGCACGAGATATGACATGGGCATGCTCGCTTTATTTTTGATATCCAATTGGTTTGTC
AACGGCGAGACTGTCTTGATTGATGGGGGCACTCTACTTGTACACCCATCTGCATATTAA
Gene >Agabi119p4|110500
ATGACAGACACAAAATCCATTTTGAACGGGTTGACTGTGCAAAACCTGTTTGATATGCGAGGCGTGGTAGCTGTT
GTGACAGGTGGTGCTTCTGTGAGGCCTATTAATATCTCCCAAGATACACAATTGAACATGATCCATGTGGAATGT
AGGGCATTGGGCTTATGATAAGTTCGACACTTATGGCCAATGGGGCGAAGGTGTACGTAGTTGATAAAGAACAGG
AACGCATAGAAAGGTAAAGGAGACTACATCGTGTTCAGCGACATTCACTCACTTTTGTGTTTTCAGGGTTCCGAA
AAGGTACAATGAGAGTGCTACACCTCAAATGGGTAGCTTGATTGGTATTCAGGCGGATATCAGCCAAAAGGTTCA
ATTATCCTATACATGCACCCGCGTCGACTTTCGGGCTAATAACATGATAAATGCAACCTACAGTCGGAAGCAACT
CGTCTAGCCAACCATATTTCCTCCCTCGAGCCAAATGGGATAACTGCTTTATTCAACAACGCGGGTATATCCACG
GGAGCTTTCAAACGCCCTGACCCGAAAACCAATCCAACTGCACAAGACTTTGTCAAAGCATTATTCGATGATGTT
CCCGAGCATACGTTTACGGATACATACAAAGTCAACGCAGTGGGACCTTATTGGTTGACGTTTGCTTTTTTACCT
TTACTTGAGAAACGCAAGTTGTATCAAGAGGCTAATGCGGAAAAAATAGAAGCGAATGGTGGGAGAGGGTATGTG
CCTTCGATTATTATGACTAGCAGTATGAATGGTTGGACAAAGGTACGATCTGATCAGTTGTTAGTAGATGGCACT
TCTGACTTTTTGGCTTTCAAGGACCTCGCCACTGCAGCATATTCATACCCTTATTCATTTTCTAAATCTGCTATC
GGCACGGGTACCGCTGCACTTGCACATGAATTGCTACCCCTCGGAATCAGGGTAAATGGTATCGCTCCGGGTTTA
TTCCCTTCAGAGGTACATTACACCGTTGACAAGCGTACCTAATTAATCTGATGATATCTTTACAAGATGGCCTCG
CCCGGAACTTCAAGTTCACTCGGGGTATCTAGCACATCCGGGAGAGACTTTCCTTTTGTCACACCTGTGAATAGG
GATGGTGGCACGAGATATGACATGGGCATGCTCGCTTTATTTTTGATATCCAATTGGTTTGTCAACGGCGAGACT
GTCTTGATTGATGGGGGCGTAAGTTTGAATTCCCTTCTCAGCTCTCTTTGCGAAATGCTGATCTTTGGCGGCCTT
TTATTTAGACTCTACTTGTACACCCATCTGCATATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail