Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|110430
Gene name
Locationscaffold_08:991717..993097
Strand+
Gene length (bp)1380
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53 3.1E-82 24 349

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1D3T4|GANA_NEOFI Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=galA PE=3 SV=1 6 349 4.0E-95
sp|B0XPR3|GANA_ASPFC Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=galA PE=3 SV=2 19 350 2.0E-92
sp|Q4WJ80|GANA_ASPFU Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=galA PE=3 SV=2 19 350 2.0E-91
sp|P83692|GANA_THIHE Arabinogalactan endo-beta-1,4-galactanase OS=Thielavia heterothallica PE=1 SV=1 21 349 6.0E-89
sp|Q5B153|GANA_EMENI Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=galA PE=1 SV=2 15 351 1.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1D3T4|GANA_NEOFI Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=galA PE=3 SV=1 6 349 4.0E-95
sp|B0XPR3|GANA_ASPFC Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=galA PE=3 SV=2 19 350 2.0E-92
sp|Q4WJ80|GANA_ASPFU Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=galA PE=3 SV=2 19 350 2.0E-91
sp|P83692|GANA_THIHE Arabinogalactan endo-beta-1,4-galactanase OS=Thielavia heterothallica PE=1 SV=1 21 349 6.0E-89
sp|Q5B153|GANA_EMENI Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=galA PE=1 SV=2 15 351 1.0E-88
sp|P83691|GANA_HUMIN Arabinogalactan endo-beta-1,4-galactanase OS=Humicola insolens PE=1 SV=1 21 349 3.0E-87
sp|Q0CTQ7|GANA_ASPTN Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=galA PE=3 SV=1 19 349 6.0E-87
sp|P48842|GANA_ASPAC Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus GN=gal1 PE=1 SV=1 23 337 8.0E-86
sp|A2RB93|GANA_ASPNC Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=galA PE=3 SV=1 23 337 4.0E-85
sp|Q8X168|GANA_ASPNG Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger GN=galA PE=1 SV=1 23 337 5.0E-85
sp|Q9Y7F8|GANA_ASPTU Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis GN=galA PE=2 SV=1 23 351 5.0E-85
sp|B8NNI2|GANA_ASPFN Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=galA PE=3 SV=1 6 349 2.0E-84
sp|Q2UN61|GANA_ASPOR Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=galA PE=3 SV=1 6 349 9.0E-84
sp|P48843|YBAB_BACCI Uncharacterized protein in bgaB 5'region (Fragment) OS=Bacillus circulans PE=3 SV=1 26 321 2.0E-41
sp|Q65CX5|GANA_BACLD Arabinogalactan endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ganB PE=1 SV=1 25 321 5.0E-37
sp|O07013|GANA_BACSU Arabinogalactan endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) GN=ganB PE=1 SV=1 25 321 2.0E-36
sp|P48841|GANA_CELJU Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) GN=ganB PE=1 SV=1 24 321 4.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0015926 glucosidase activity Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|110430
MILFSLLSLLLTLLITQLTQALTYRGADFSSLAILESSGRTYQDSSSSSKRPFETILSSHGTNLARIRIWTGQEY
SLDYGLRLARRAVNAGMNVMVDLHYSDTWADPAHQSIPSSWPRDLSGLNTKIFTYTRDIVNAFANQGTPMQFIQI
GNEINDGFLWPTAQISKSGFSPPSQLLHSAANGVRSATGGSSIKIMVHVSNGWDSGLQNFFYDGIFRPGEFATGD
FDLFGVSFYPFYGREATFERLRSTLTGLVNKYNKDVMVVETDWPAIGSCPGVSLSENSISISTNGQIQWVNGIKN
VLNQLPGGHGIGFVYWEPGWIGNAGLGSSCSDNLLVDNQGVSRASMSMFSN*
Coding >Agabi119p4|110430
ATGATATTATTCTCCCTCCTCTCTCTCCTCCTCACACTCCTCATCACTCAATTAACTCAAGCTCTAACCTACCGC
GGTGCCGATTTCTCCTCCCTCGCCATTCTCGAATCTTCCGGTCGCACCTACCAAGATTCTTCTTCCTCTTCTAAA
CGCCCTTTCGAAACTATTCTAAGTTCTCATGGAACCAATCTTGCTAGGATACGAATTTGGACGGGACAGGAATAT
AGTTTGGATTATGGATTGAGGTTGGCGAGGAGGGCTGTTAATGCTGGGATGAATGTTATGGTGGATTTGCATTAT
AGTGATACTTGGGCTGATCCGGCACATCAATCTATTCCATCTTCGTGGCCGAGAGATCTCTCGGGTTTGAACACG
AAAATCTTCACTTACACCCGCGATATCGTCAACGCATTCGCCAACCAAGGAACCCCAATGCAATTCATCCAAATC
GGTAACGAAATCAACGACGGCTTCCTCTGGCCCACCGCTCAAATATCCAAATCCGGATTCTCTCCACCCTCCCAA
CTCCTTCATTCAGCTGCCAATGGTGTACGTTCAGCCACAGGAGGATCTTCCATCAAAATCATGGTCCATGTATCC
AATGGTTGGGATTCCGGTTTACAAAATTTCTTTTATGATGGTATTTTTCGACCTGGAGAATTTGCGACGGGTGAT
TTTGATTTGTTTGGGGTTTCGTTTTATCCGTTTTATGGAAGGGAGGCGACGTTTGAGAGGTTGAGAAGTACGTTG
ACGGGGTTGGTTAATAAATACAACAAGGATGTTATGGTGGTTGAAACGGATTGGCCAGCTATAGGTTCATGTCCT
GGTGTATCTCTCAGCGAAAACTCTATTTCTATATCCACAAACGGTCAAATTCAATGGGTGAATGGAATCAAAAAC
GTTTTGAATCAATTACCTGGTGGACATGGTATTGGATTTGTGTATTGGGAACCTGGATGGATTGGGAATGCGGGG
TTGGGATCGAGTTGTAGTGATAATTTGTTGGTTGATAACCAGGGCGTTTCGAGGGCTAGCATGTCTATGTTTTCT
AATTGA
Transcript >Agabi119p4|110430
ATGATATTATTCTCCCTCCTCTCTCTCCTCCTCACACTCCTCATCACTCAATTAACTCAAGCTCTAACCTACCGC
GGTGCCGATTTCTCCTCCCTCGCCATTCTCGAATCTTCCGGTCGCACCTACCAAGATTCTTCTTCCTCTTCTAAA
CGCCCTTTCGAAACTATTCTAAGTTCTCATGGAACCAATCTTGCTAGGATACGAATTTGGACGGGACAGGAATAT
AGTTTGGATTATGGATTGAGGTTGGCGAGGAGGGCTGTTAATGCTGGGATGAATGTTATGGTGGATTTGCATTAT
AGTGATACTTGGGCTGATCCGGCACATCAATCTATTCCATCTTCGTGGCCGAGAGATCTCTCGGGTTTGAACACG
AAAATCTTCACTTACACCCGCGATATCGTCAACGCATTCGCCAACCAAGGAACCCCAATGCAATTCATCCAAATC
GGTAACGAAATCAACGACGGCTTCCTCTGGCCCACCGCTCAAATATCCAAATCCGGATTCTCTCCACCCTCCCAA
CTCCTTCATTCAGCTGCCAATGGTGTACGTTCAGCCACAGGAGGATCTTCCATCAAAATCATGGTCCATGTATCC
AATGGTTGGGATTCCGGTTTACAAAATTTCTTTTATGATGGTATTTTTCGACCTGGAGAATTTGCGACGGGTGAT
TTTGATTTGTTTGGGGTTTCGTTTTATCCGTTTTATGGAAGGGAGGCGACGTTTGAGAGGTTGAGAAGTACGTTG
ACGGGGTTGGTTAATAAATACAACAAGGATGTTATGGTGGTTGAAACGGATTGGCCAGCTATAGGTTCATGTCCT
GGTGTATCTCTCAGCGAAAACTCTATTTCTATATCCACAAACGGTCAAATTCAATGGGTGAATGGAATCAAAAAC
GTTTTGAATCAATTACCTGGTGGACATGGTATTGGATTTGTGTATTGGGAACCTGGATGGATTGGGAATGCGGGG
TTGGGATCGAGTTGTAGTGATAATTTGTTGGTTGATAACCAGGGCGTTTCGAGGGCTAGCATGTCTATGTTTTCT
AATTGA
Gene >Agabi119p4|110430
ATGATATTATTCTCCCTCCTCTCTCTCCTCCTCACACTCCTCATCACTCAATTAACTCAAGCTCTAACCTACCGC
GGTGCCGATTTCTCCTCCCTCGCCATTCTCGAATCTTCCGGTCGCACCTACCAAGATTCTTCTTCCTCTTCTAAA
CGCCCTTTCGAAACTATTCTAAGTTCTCATGGAACCAATCTTGCTAGGATACGAATTTGGACGGGACAGGAATAT
AGTTTGGATTATGGATTGAGGTTGGCGAGGAGGGCTGTTAATGCTGGGATGAATGTTATGGTGGATTTGCATTAT
AGTGATACTTGTGAGTTTTTGACCTGGTTTTTTTTTTTTTGGTGAACTTTTTTTTTTGGTGAACTTTTTTTTTTT
TTTTTGTTGATTGTGGGTGGATTTGATTTGTAGGGGCTGATCCGGCACATCAATCTATTCCATCTTCGTGGCCGA
GAGATCTCTCGGGTTTGAACACGAAAATCTTCACGTAAGTTTTCATCATCACCTATATCTCTTCATTACACTTCC
TCTTTCATAAGTTACACCCGCGATATCGTCAACGCATTCGCCAACCAAGGAACCCCAATGCAATTCATCCAAGTA
CATAACCAAAACTCCTTTACTTTTCTTCCCTAACTCTCTCTCACACACCCATACATAGATCGGTAACGAAATCAA
CGACGGCTTCCTCTGGCCCACCGCTCAAATATCCAAATCCGGATTCTCTCCACCCTCCCAACTCCTTCATTCAGC
TGCCAATGGTGTACGTTCAGCCACAGGAGGATCTTCCATCAAAATCATGGTCCATGTATCCAATGGTTGGGATTC
CGGTTTACAAAATTTCTTTTATGATGGTATTTTTCGACCTGGAGAATTTGCGACGGGTGATTTTGATTTGTTTGG
GGTTTCGTTTTATCCGTTTTATGGAAGGGAGGCGACGTTTGAGAGGTTGAGAAGTACGTTGACGGGGTTGGTTAA
TAAATACAACAAGGTTCGGGCAAATTTATCTGATATTTTTTAACTTCTTGATGATTTATTGATAAGGATGTTATG
GTGGTTGAAACGGATTGGCCAGCTATAGGTTCATGTCCTGGTGTATCTCTCAGCGAAAACTCTATTTCTATATCC
ACAAACGGTCAAATTCAATGGGTGAATGGAATCAAAAACGTTTTGAATCAATTACCTGGTGGACATGGTATTGGA
TTTGTGTATTGGGAACCTGGATGGATTGGGAATGCGGGGTTGGGATCGAGTTGTAGTGTAAGTATTTCTAGTATT
CGATTTCCCCCAAAAAAAATATCTTACTGATAATTTTTGAAGGATAATTTGTTGGTTGATAACCAGGGCGTTTCG
AGGGCTAGCATGTCTATGTTTTCTAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail