Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|110340
Gene name
Locationscaffold_08:949457..950402
Strand-
Gene length (bp)945
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05817 Ribophorin_II Oligosaccharyltransferase subunit Ribophorin II 4.3E-33 20 269

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P91390|RPN2_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Caenorhabditis elegans GN=ostd-1 PE=3 SV=1 31 271 2.0E-14
sp|Q9DBG6|RPN2_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mus musculus GN=Rpn2 PE=1 SV=1 47 271 3.0E-12
sp|P25235|RPN2_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Rattus norvegicus GN=Rpn2 PE=2 SV=2 47 271 4.0E-12
sp|P04844|RPN2_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens GN=RPN2 PE=1 SV=3 47 271 7.0E-12
sp|Q5RBM1|RPN2_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Pongo abelii GN=RPN2 PE=2 SV=1 47 271 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P91390|RPN2_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Caenorhabditis elegans GN=ostd-1 PE=3 SV=1 31 271 2.0E-14
sp|Q9DBG6|RPN2_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mus musculus GN=Rpn2 PE=1 SV=1 47 271 3.0E-12
sp|P25235|RPN2_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Rattus norvegicus GN=Rpn2 PE=2 SV=2 47 271 4.0E-12
sp|P04844|RPN2_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens GN=RPN2 PE=1 SV=3 47 271 7.0E-12
sp|Q5RBM1|RPN2_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Pongo abelii GN=RPN2 PE=2 SV=1 47 271 9.0E-12
sp|Q3SZI6|RPN2_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Bos taurus GN=RPN2 PE=2 SV=1 47 271 2.0E-11
sp|Q9GL01|RPN2_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Sus scrofa GN=RPN2 PE=2 SV=1 47 271 2.0E-11
sp|Q93Z16|RPN2_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Arabidopsis thaliana GN=RPN2 PE=2 SV=1 20 268 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006487 protein N-linked glycosylation Yes
GO:0008250 oligosaccharyltransferase complex Yes
GO:0016021 integral component of membrane Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0032991 protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0006486 protein glycosylation No
GO:1990234 transferase complex No
GO:0044238 primary metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0019538 protein metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0098796 membrane protein complex No
GO:0070085 glycosylation No
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0036211 protein modification process No
GO:1902494 catalytic complex No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 184 203 19
2 216 238 22
3 242 264 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|110340
MHVFVASLLLLVASVHAKILTLQSPRFVVLDSQGQQSRSEPISLTQKSRNPVFLNATDTLKVTFQVVDKESGEGT
QPHQTFLRFYDATTDEEGIQPIRVTQGGKAKLELNMARPPLSLPPTGDVPLQVMLYIGQPNFSPIAVELFDLHVP
HSQPPPAHPDEASFHLLPEIHHIFRPDQKLPYKLVSAVFSGLVIAPWFLLVGLWSQVSPRLTHLFSPNVLPFILS
LGAYEFLVFYYWVDLKLGQVLLCGGVLAIINLFTGKHALSSIAKRRLNKN*
Coding >Agabi119p4|110340
ATGCACGTCTTCGTCGCGTCGCTGCTTCTCCTCGTTGCTTCTGTTCACGCGAAAATCCTTACACTTCAATCTCCG
CGCTTCGTCGTACTTGATTCGCAGGGACAGCAGTCCCGTTCAGAGCCCATCTCTCTTACCCAGAAATCCAGAAAT
CCAGTGTTTCTGAATGCCACAGATACTCTCAAGGTCACCTTCCAAGTAGTTGACAAAGAGTCTGGCGAAGGGACA
CAACCACACCAAACTTTTCTTCGTTTCTATGATGCCACGACGGACGAAGAGGGTATCCAACCCATTCGTGTCACC
CAAGGCGGCAAGGCTAAACTTGAGCTAAACATGGCCCGCCCTCCTCTCAGCTTACCACCGACTGGCGACGTTCCA
TTGCAGGTGATGCTGTATATCGGACAACCCAACTTCTCTCCTATTGCCGTCGAGTTATTCGACCTCCATGTCCCA
CATTCCCAGCCTCCTCCCGCGCATCCCGACGAAGCTTCCTTCCATCTACTCCCGGAAATTCATCATATCTTCAGG
CCTGACCAGAAACTGCCGTACAAGCTTGTTTCAGCTGTATTCTCCGGCCTGGTTATCGCACCCTGGTTCCTCCTT
GTCGGTCTCTGGTCCCAGGTTTCTCCTCGTCTCACCCATTTATTCTCGCCCAATGTCCTTCCTTTCATCCTCAGT
CTTGGCGCTTATGAATTTCTCGTATTTTATTACTGGGTTGACCTCAAACTTGGCCAAGTCCTCCTTTGCGGCGGC
GTCCTTGCTATCATCAATCTCTTCACTGGCAAACATGCTCTTAGTAGCATCGCCAAGCGACGATTGAATAAAAAT
TAG
Transcript >Agabi119p4|110340
ATGCACGTCTTCGTCGCGTCGCTGCTTCTCCTCGTTGCTTCTGTTCACGCGAAAATCCTTACACTTCAATCTCCG
CGCTTCGTCGTACTTGATTCGCAGGGACAGCAGTCCCGTTCAGAGCCCATCTCTCTTACCCAGAAATCCAGAAAT
CCAGTGTTTCTGAATGCCACAGATACTCTCAAGGTCACCTTCCAAGTAGTTGACAAAGAGTCTGGCGAAGGGACA
CAACCACACCAAACTTTTCTTCGTTTCTATGATGCCACGACGGACGAAGAGGGTATCCAACCCATTCGTGTCACC
CAAGGCGGCAAGGCTAAACTTGAGCTAAACATGGCCCGCCCTCCTCTCAGCTTACCACCGACTGGCGACGTTCCA
TTGCAGGTGATGCTGTATATCGGACAACCCAACTTCTCTCCTATTGCCGTCGAGTTATTCGACCTCCATGTCCCA
CATTCCCAGCCTCCTCCCGCGCATCCCGACGAAGCTTCCTTCCATCTACTCCCGGAAATTCATCATATCTTCAGG
CCTGACCAGAAACTGCCGTACAAGCTTGTTTCAGCTGTATTCTCCGGCCTGGTTATCGCACCCTGGTTCCTCCTT
GTCGGTCTCTGGTCCCAGGTTTCTCCTCGTCTCACCCATTTATTCTCGCCCAATGTCCTTCCTTTCATCCTCAGT
CTTGGCGCTTATGAATTTCTCGTATTTTATTACTGGGTTGACCTCAAACTTGGCCAAGTCCTCCTTTGCGGCGGC
GTCCTTGCTATCATCAATCTCTTCACTGGCAAACATGCTCTTAGTAGCATCGCCAAGCGACGATTGAATAAAAAT
TAG
Gene >Agabi119p4|110340
ATGCACGTCTTCGTCGCGTCGCTGCTTCTCCTCGTTGCTTCTGTTCACGCGAAAATCCTTACACTTCAATCTCCG
CGCTTCGTCGTACTTGATTCGCAGGGACAGCAGTCCCGTTCAGAGCCGTATGTTGCATCTATTGTATATCATTCT
CACCACAATTGGTAAACCAGGCCCACAGCATCTCTCTTACCCAGAAATCCAGAAATCCAGTGTTTCTGAATGCCA
CAGATACTCTCAAGGTCACCTTCCAAGTAGTTGACAAAGAGTCTGGCGAAGGGACACAACCACACCAAACTTTTC
TTCGTTTCTATGATGCCACGACGGACGAAGAGGGTATCCAACCCATTCGTGTCACCCAAGGCGGCAAGGCTAAAC
TTGAGCTAAACATGGCCCGCCCTCCTCTCAGCTTACCACCGACTGGCGACGTTCCATTGCAGGTGATGCTGTATA
TCGGACAACCCAACTTCTCTCCTATTGCCGTCGAGTTATTCGACCTCCATGTCCCACATTCCCAGCCTCCTCCCG
CGCATCCCGACGAAGCTTCCTTCCATCTACTCCCGGAAATTCATCATATCTTCAGGCCTGACCAGAAACTGCCGT
ACAAGCTTGTTTCAGCTGTATTCTCCGGCCTGGTTATCGCACCCTGGTTCCTCCTTGTCGGTCTCGTGCGTTTTG
CTATTCTTATAAATTGCGTTCTTGCTGATAGGATTAATATATTCTTCGCAGTGGTCCCAGGTTTCTCCTCGTCTC
ACCCATTTATTCTCGCCCAATGTCCTTCCTTTCATCCTCAGTCTTGGCGCTTATGAATTTCTCGTATTTTATTAC
TGGGTTGACCTCAAACTTGGCCAAGTCCTCCTTTGCGGCGGCGTCCTTGCTATCATCAATCTCTTCACTGGCAAA
CATGCTCTTAGTAGCATCGCCAAGCGACGATTGAATAAAAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail