© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|109970 |
| Gene name | |
| Location | scaffold_08:877149..878204 |
| Strand | + |
| Gene length (bp) | 1055 |
| Transcript length (bp) | 567 |
| Coding sequence length (bp) | 567 |
| Protein length (aa) | 189 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01849 | NAC | NAC domain | 7.0E-23 | 63 | 118 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A1CMP1|NACB_ASPCL | Nascent polypeptide-associated complex subunit beta OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=egd1 PE=3 SV=1 | 24 | 180 | 1.0E-66 |
| sp|Q0CGL5|NACB_ASPTN | Nascent polypeptide-associated complex subunit beta OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd1 PE=3 SV=1 | 24 | 180 | 2.0E-63 |
| sp|A2R091|NACB_ASPNC | Nascent polypeptide-associated complex subunit beta OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=egd1 PE=3 SV=1 | 24 | 180 | 2.0E-61 |
| sp|Q1DI23|NACB_COCIM | Nascent polypeptide-associated complex subunit beta OS=Coccidioides immitis (strain RS) GN=EGD1 PE=3 SV=1 | 24 | 180 | 9.0E-61 |
| sp|A1DL98|NACB_NEOFI | Nascent polypeptide-associated complex subunit beta OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=egd1 PE=3 SV=1 | 24 | 180 | 9.0E-61 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A1CMP1|NACB_ASPCL | Nascent polypeptide-associated complex subunit beta OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=egd1 PE=3 SV=1 | 24 | 180 | 1.0E-66 |
| sp|Q0CGL5|NACB_ASPTN | Nascent polypeptide-associated complex subunit beta OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd1 PE=3 SV=1 | 24 | 180 | 2.0E-63 |
| sp|A2R091|NACB_ASPNC | Nascent polypeptide-associated complex subunit beta OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=egd1 PE=3 SV=1 | 24 | 180 | 2.0E-61 |
| sp|Q1DI23|NACB_COCIM | Nascent polypeptide-associated complex subunit beta OS=Coccidioides immitis (strain RS) GN=EGD1 PE=3 SV=1 | 24 | 180 | 9.0E-61 |
| sp|A1DL98|NACB_NEOFI | Nascent polypeptide-associated complex subunit beta OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=egd1 PE=3 SV=1 | 24 | 180 | 9.0E-61 |
| sp|Q7SDU4|NACB_NEUCR | Nascent polypeptide-associated complex subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-2 PE=3 SV=2 | 31 | 180 | 1.0E-60 |
| sp|P0CP08|NACB_CRYNJ | Nascent polypeptide-associated complex subunit beta OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EGD1 PE=3 SV=1 | 24 | 184 | 1.0E-60 |
| sp|P0CP09|NACB_CRYNB | Nascent polypeptide-associated complex subunit beta OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EGD1 PE=3 SV=1 | 24 | 184 | 1.0E-60 |
| sp|Q2H4X9|NACB_CHAGB | Nascent polypeptide-associated complex subunit beta OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD1 PE=3 SV=1 | 31 | 180 | 5.0E-60 |
| sp|Q4WCX4|NACB_ASPFU | Nascent polypeptide-associated complex subunit beta OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=egd1 PE=3 SV=1 | 24 | 180 | 8.0E-60 |
| sp|Q0ULD0|NACB_PHANO | Nascent polypeptide-associated complex subunit beta OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=EGD1 PE=3 SV=1 | 24 | 182 | 3.0E-59 |
| sp|A6R5Z3|NACB_AJECN | Nascent polypeptide-associated complex subunit beta OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=EGD1 PE=3 SV=1 | 24 | 180 | 1.0E-58 |
| sp|Q5ASI4|NACB_EMENI | Nascent polypeptide-associated complex subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=egd1 PE=3 SV=1 | 24 | 176 | 5.0E-57 |
| sp|A7F9B8|NACB_SCLS1 | Nascent polypeptide-associated complex subunit beta OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd1 PE=3 SV=1 | 24 | 180 | 7.0E-57 |
| sp|A6S6B0|NACB_BOTFB | Nascent polypeptide-associated complex subunit beta OS=Botryotinia fuckeliana (strain B05.10) GN=egd1 PE=3 SV=1 | 24 | 180 | 7.0E-57 |
| sp|Q4P9Y9|NACB_USTMA | Nascent polypeptide-associated complex subunit beta OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EGD1 PE=3 SV=1 | 24 | 150 | 6.0E-55 |
| sp|Q2U6N1|NACB_ASPOR | Nascent polypeptide-associated complex subunit beta OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=egd1 PE=3 SV=1 | 17 | 180 | 1.0E-53 |
| sp|Q4I283|NACB_GIBZE | Nascent polypeptide-associated complex subunit beta OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD1 PE=3 SV=2 | 38 | 182 | 3.0E-53 |
| sp|A4RC23|NACB_MAGO7 | Nascent polypeptide-associated complex subunit beta OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD1 PE=3 SV=2 | 43 | 180 | 3.0E-53 |
| sp|Q92371|NACB_SCHPO | Nascent polypeptide-associated complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btf3 PE=2 SV=2 | 24 | 176 | 3.0E-48 |
| sp|Q64152|BTF3_MOUSE | Transcription factor BTF3 OS=Mus musculus GN=Btf3 PE=1 SV=3 | 24 | 176 | 2.0E-47 |
| sp|P20290|BTF3_HUMAN | Transcription factor BTF3 OS=Homo sapiens GN=BTF3 PE=1 SV=1 | 24 | 176 | 3.0E-47 |
| sp|Q6PC91|BT3L4_DANRE | Transcription factor BTF3 homolog 4 OS=Danio rerio GN=btf3l4 PE=2 SV=1 | 24 | 176 | 3.0E-44 |
| sp|Q4KLF5|BT3L4_XENLA | Transcription factor BTF3 homolog 4 OS=Xenopus laevis GN=btf3l4 PE=2 SV=1 | 24 | 176 | 3.0E-43 |
| sp|Q5M8V0|BT3L4_XENTR | Transcription factor BTF3 homolog 4 OS=Xenopus tropicalis GN=btf3l4 PE=2 SV=1 | 24 | 176 | 3.0E-43 |
| sp|Q2KIY7|BT3L4_BOVIN | Transcription factor BTF3 homolog 4 OS=Bos taurus GN=BTF3L4 PE=2 SV=1 | 24 | 176 | 4.0E-43 |
| sp|Q5RC59|BT3L4_PONAB | Transcription factor BTF3 homolog 4 OS=Pongo abelii GN=BTF3L4 PE=2 SV=1 | 24 | 176 | 5.0E-43 |
| sp|Q9CQH7|BT3L4_MOUSE | Transcription factor BTF3 homolog 4 OS=Mus musculus GN=Btf3l4 PE=1 SV=1 | 24 | 176 | 5.0E-43 |
| sp|Q96K17|BT3L4_HUMAN | Transcription factor BTF3 homolog 4 OS=Homo sapiens GN=BTF3L4 PE=1 SV=1 | 24 | 176 | 5.0E-43 |
| sp|Q5ZJG3|BT3L4_CHICK | Transcription factor BTF3 homolog 4 OS=Gallus gallus GN=BTF3L4 PE=2 SV=1 | 24 | 176 | 1.0E-42 |
| sp|Q18885|BTF3_CAEEL | Transcription factor BTF3 homolog OS=Caenorhabditis elegans GN=icd-1 PE=1 SV=1 | 28 | 185 | 7.0E-40 |
| sp|Q6C2F3|NACB_YARLI | Nascent polypeptide-associated complex subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EGD1 PE=3 SV=1 | 24 | 176 | 5.0E-38 |
| sp|Q6BLV1|NACB_DEBHA | Nascent polypeptide-associated complex subunit beta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EGD1 PE=3 SV=1 | 24 | 173 | 2.0E-33 |
| sp|Q59TU0|NACB_CANAL | Nascent polypeptide-associated complex subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EGD1 PE=3 SV=1 | 24 | 173 | 2.0E-29 |
| sp|A5DT59|NACB_LODEL | Nascent polypeptide-associated complex subunit beta OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=EGD1 PE=3 SV=1 | 24 | 173 | 4.0E-28 |
| sp|Q6FKD1|NACB_CANGA | Nascent polypeptide-associated complex subunit beta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EGD1 PE=3 SV=1 | 24 | 180 | 6.0E-26 |
| sp|Q751F1|NACB_ASHGO | Nascent polypeptide-associated complex subunit beta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EGD1 PE=3 SV=1 | 24 | 180 | 7.0E-26 |
| sp|Q02642|NACB1_YEAST | Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EGD1 PE=1 SV=2 | 24 | 180 | 2.0E-25 |
| sp|A6ZWL1|NACB1_YEAS7 | Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain YJM789) GN=EGD1 PE=3 SV=1 | 24 | 180 | 2.0E-25 |
| sp|A5DF06|NACB_PICGU | Nascent polypeptide-associated complex subunit beta OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EGD1 PE=3 SV=2 | 24 | 173 | 2.0E-25 |
| sp|A3GHR2|NACB_PICST | Nascent polypeptide-associated complex subunit beta OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=EGD1 PE=3 SV=1 | 41 | 173 | 5.0E-25 |
| sp|Q54TR8|NACB_DICDI | Nascent polypeptide-associated complex subunit beta OS=Dictyostelium discoideum GN=nacB PE=3 SV=1 | 40 | 172 | 4.0E-24 |
| sp|Q6CR46|NACB_KLULA | Nascent polypeptide-associated complex subunit beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EGD1 PE=3 SV=1 | 24 | 180 | 7.0E-18 |
| sp|A6ZYK4|NACB2_YEAS7 | Nascent polypeptide-associated complex subunit beta-2 OS=Saccharomyces cerevisiae (strain YJM789) GN=BTT1 PE=3 SV=1 | 24 | 151 | 6.0E-16 |
| sp|P40314|NACB2_YEAST | Nascent polypeptide-associated complex subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BTT1 PE=1 SV=1 | 24 | 151 | 9.0E-16 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|109970 MMLTKPTAVLASAPLLPLPVKPTMDPAKLAKLQAASAVNRIGGKGTVRRKVVRKPKASTAQDDKKLQGALKKLNV QPVTGVEEVNMFREDGNVLHFTAPKVHAAVTANTFAVYGQGHVKELTELVPGILNQLGPDSLASLRKLAESYQAI QQSQQRPAGAADDDDDDVPDLVENFEAEPETQKAAALD* |
| Coding | >Agabi119p4|109970 ATGATGTTGACAAAGCCAACAGCTGTTCTCGCCTCCGCACCTCTCCTCCCCCTTCCGGTGAAACCTACCATGGAT CCAGCAAAATTAGCCAAACTCCAGGCTGCCTCCGCCGTCAACCGAATCGGCGGAAAGGGGACCGTTCGCCGAAAG GTTGTGCGAAAACCCAAGGCATCGACAGCTCAAGATGATAAAAAGCTACAGGGTGCACTGAAGAAGTTGAACGTG CAACCTGTTACTGGTGTAGAGGAAGTCAACATGTTTAGGGAGGATGGAAACGTTTTACACTTTACGGCTCCTAAG GTGCACGCGGCCGTCACTGCAAACACTTTCGCTGTTTACGGCCAAGGTCACGTCAAAGAGCTCACAGAACTAGTT CCTGGAATTCTCAATCAACTCGGACCTGACTCTCTCGCATCGCTACGCAAATTGGCGGAGTCATACCAGGCTATT CAACAAAGCCAACAGAGGCCTGCTGGCGCCGCGGACGATGACGATGACGACGTACCTGACCTTGTGGAGAACTTT GAGGCGGAACCAGAGACCCAAAAGGCTGCAGCACTTGATTGA |
| Transcript | >Agabi119p4|109970 ATGATGTTGACAAAGCCAACAGCTGTTCTCGCCTCCGCACCTCTCCTCCCCCTTCCGGTGAAACCTACCATGGAT CCAGCAAAATTAGCCAAACTCCAGGCTGCCTCCGCCGTCAACCGAATCGGCGGAAAGGGGACCGTTCGCCGAAAG GTTGTGCGAAAACCCAAGGCATCGACAGCTCAAGATGATAAAAAGCTACAGGGTGCACTGAAGAAGTTGAACGTG CAACCTGTTACTGGTGTAGAGGAAGTCAACATGTTTAGGGAGGATGGAAACGTTTTACACTTTACGGCTCCTAAG GTGCACGCGGCCGTCACTGCAAACACTTTCGCTGTTTACGGCCAAGGTCACGTCAAAGAGCTCACAGAACTAGTT CCTGGAATTCTCAATCAACTCGGACCTGACTCTCTCGCATCGCTACGCAAATTGGCGGAGTCATACCAGGCTATT CAACAAAGCCAACAGAGGCCTGCTGGCGCCGCGGACGATGACGATGACGACGTACCTGACCTTGTGGAGAACTTT GAGGCGGAACCAGAGACCCAAAAGGCTGCAGCACTTGATTGA |
| Gene | >Agabi119p4|109970 ATGATGTGTACATGTGTTTGGTTGAACCTTATTGCGCCAGACCGGACAATGGTCGGCCTCGTCAGTGACAAAGCC AACAGCTGTTCTCGCCTCCGCACCTCTCCTCCCCCTTCCGGTGGTAATTTTTTCTGAATCTCCAGCAAAGTGTCC TTTTTCACCTAATGTCTTCCAGAAACCTACCATGGATCCAGCAAAATTAGCCAAACTCCAGGCTGCCTCCGCCGT CAACCGAATCGGTGCGTTTCTACTCAGATCTCACTGATTCGCCAAGATACGTGTTGGCTGACGTGCCGAATCCCA TTTTTTCACTTATTGTTGCGTTATATGACTGTTGAAATCCATCGATATCTTCAAATTCCAATATTATGCGTCTCA ATCATTCTACGACTCAAATGCTTGTGCGATGCTCGATATATGCGCGGATGTATCGTGTACCAACGCGTATAGGCG GAAAGGGGACCGTTCGCCGAAAGGTTGTGCGAAAACCCAAGGCATCGACAGCTCAAGATGATAAAAAGCTACAGG GTGCACTGAAGAAGTTGAACGTGCAACCTGTTACTGGTGTAGAGGAAGTCAACATGTTTAGGGAGGATGGAAACG TTTTACACTTTACGGCTCCTAAGGGTGAGTTTATCTACTCCTCGGCTTGGTATTCTCTTCAAATTCTGTTGCGTT CATTTGTCGACTTATTCGATTATCTATTTATTTTCATCGCGCCGTTTGATAACTCCATATGCATTCGCGAACGCA CTGGCATGTACTAACACCATTTTTCTTGCAAATTTTTAGTGCACGCGGCCGTCACTGCAAACACTTTCGCTGTTT ACGGCCAAGGTCACGTCAAAGAGCTCACAGAACTAGTTCCTGGAATTCTCAATCAACTCGGACCTGACTCTCTCG CATCGCTACGCAAATTGGCGGAGTCATACCAGGCTATTCAACAAAGCCAACAGAGGCCTGCTGGCGCCGCGGACG ATGACGATGACGACGTACCTGACCTTGTGGAGAACTTTGAGGCGGAACCAGAGACCCAAAAGGCTGCAGCACTTG ATTGA |