Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|109640
Gene name
Locationscaffold_08:782162..783078
Strand+
Gene length (bp)916
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family 5.4E-48 11 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7W2|FTHC_SCHPO Probable 5-formyltetrahydrofolate cyclo-ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1703.08c PE=3 SV=1 7 211 6.0E-40
sp|Q9XWE6|MTHFS_CAEEL Probable 5-formyltetrahydrofolate cyclo-ligase OS=Caenorhabditis elegans GN=Y106G6E.4 PE=3 SV=1 1 219 1.0E-34
sp|Q9D110|MTHFS_MOUSE 5-formyltetrahydrofolate cyclo-ligase OS=Mus musculus GN=Mthfs PE=2 SV=2 11 216 7.0E-34
sp|P80405|MTHFS_RABIT 5-formyltetrahydrofolate cyclo-ligase OS=Oryctolagus cuniculus GN=MTHFS PE=1 SV=1 11 206 1.0E-32
sp|P40099|FTHC_YEAST 5-formyltetrahydrofolate cyclo-ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAU1 PE=1 SV=1 11 206 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7W2|FTHC_SCHPO Probable 5-formyltetrahydrofolate cyclo-ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1703.08c PE=3 SV=1 7 211 6.0E-40
sp|Q9XWE6|MTHFS_CAEEL Probable 5-formyltetrahydrofolate cyclo-ligase OS=Caenorhabditis elegans GN=Y106G6E.4 PE=3 SV=1 1 219 1.0E-34
sp|Q9D110|MTHFS_MOUSE 5-formyltetrahydrofolate cyclo-ligase OS=Mus musculus GN=Mthfs PE=2 SV=2 11 216 7.0E-34
sp|P80405|MTHFS_RABIT 5-formyltetrahydrofolate cyclo-ligase OS=Oryctolagus cuniculus GN=MTHFS PE=1 SV=1 11 206 1.0E-32
sp|P40099|FTHC_YEAST 5-formyltetrahydrofolate cyclo-ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAU1 PE=1 SV=1 11 206 2.0E-32
sp|P49914|MTHFS_HUMAN 5-formyltetrahydrofolate cyclo-ligase OS=Homo sapiens GN=MTHFS PE=1 SV=2 11 206 2.0E-29
sp|Q8L539|5FCL_ARATH 5-formyltetrahydrofolate cyclo-ligase, mitochondrial OS=Arabidopsis thaliana GN=5FCL PE=1 SV=1 10 222 8.0E-23
sp|P0AC28|5FCL_ECOLI 5-formyltetrahydrofolate cyclo-ligase OS=Escherichia coli (strain K12) GN=ygfA PE=1 SV=1 18 208 7.0E-16
sp|P0AC29|5FCL_ECO57 5-formyltetrahydrofolate cyclo-ligase OS=Escherichia coli O157:H7 GN=ygfA PE=3 SV=1 18 208 7.0E-16
sp|P54491|YQGN_BACSU Uncharacterized protein YqgN OS=Bacillus subtilis (strain 168) GN=yqgN PE=1 SV=1 11 213 2.0E-15
sp|A0R3H2|5FCL_MYCS2 5-formyltetrahydrofolate cyclo-ligase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5472 PE=1 SV=1 50 205 3.0E-13
sp|Q8K9E3|Y396_BUCAP Uncharacterized protein BUsg_396 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_396 PE=3 SV=1 10 208 1.0E-12
sp|P44905|5FCL_HAEIN 5-formyltetrahydrofolate cyclo-ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0858 PE=1 SV=1 10 196 2.0E-11
sp|Q89AD6|Y370_BUCBP Uncharacterized protein bbp_370 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bbp_370 PE=3 SV=1 12 207 4.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|109640
MSTIQSLKIQKRALRKAIGSKLSAIPTQSIQEQSYSIIQHLGSFPAFSRSKSLSCYLSMPSGEVDTSSLVSEILD
SGRTLFVPKITNRSGEMEFLKLYGKADLASLPNGVWGIKEPDSDWQGQPRAKALETSELDLILLPAVAFDRNFAR
LGHGKGYYDRFITKYQTTFHKKPLLVGLALREQLLEKERIPIDKHDWSMDFIVTPDEVLTNSSPVSFDASENAG*
Coding >Agabi119p4|109640
ATGTCCACAATTCAATCTTTGAAGATTCAAAAAAGGGCTTTGCGCAAGGCAATTGGCTCTAAGCTGTCCGCTATA
CCCACACAGTCAATTCAAGAACAATCGTACTCGATCATCCAACATTTGGGGTCCTTCCCCGCGTTTAGCCGTTCA
AAATCGCTTAGCTGCTATCTCAGCATGCCCTCGGGAGAGGTTGACACGTCTTCCCTGGTGTCCGAAATACTCGAC
TCAGGTAGGACCCTCTTCGTACCCAAAATCACAAACAGATCTGGAGAAATGGAATTCTTGAAATTGTACGGTAAG
GCTGACCTCGCAAGTCTCCCCAATGGGGTATGGGGAATCAAGGAGCCGGACTCCGATTGGCAGGGTCAACCACGT
GCGAAAGCGCTCGAAACCTCAGAATTGGATCTCATTCTCCTCCCAGCTGTTGCGTTTGATAGAAACTTTGCGCGG
CTTGGGCATGGTAAAGGATATTATGATCGTTTCATCACAAAATATCAAACAACGTTTCATAAGAAACCACTCCTA
GTCGGATTGGCACTCCGCGAACAACTGTTGGAGAAGGAAAGAATTCCCATCGACAAGCACGATTGGTCGATGGAC
TTTATCGTTACTCCGGACGAAGTTCTGACTAATTCTTCCCCCGTTTCATTTGATGCCTCAGAAAATGCAGGTTGA
Transcript >Agabi119p4|109640
ATGTCCACAATTCAATCTTTGAAGATTCAAAAAAGGGCTTTGCGCAAGGCAATTGGCTCTAAGCTGTCCGCTATA
CCCACACAGTCAATTCAAGAACAATCGTACTCGATCATCCAACATTTGGGGTCCTTCCCCGCGTTTAGCCGTTCA
AAATCGCTTAGCTGCTATCTCAGCATGCCCTCGGGAGAGGTTGACACGTCTTCCCTGGTGTCCGAAATACTCGAC
TCAGGTAGGACCCTCTTCGTACCCAAAATCACAAACAGATCTGGAGAAATGGAATTCTTGAAATTGTACGGTAAG
GCTGACCTCGCAAGTCTCCCCAATGGGGTATGGGGAATCAAGGAGCCGGACTCCGATTGGCAGGGTCAACCACGT
GCGAAAGCGCTCGAAACCTCAGAATTGGATCTCATTCTCCTCCCAGCTGTTGCGTTTGATAGAAACTTTGCGCGG
CTTGGGCATGGTAAAGGATATTATGATCGTTTCATCACAAAATATCAAACAACGTTTCATAAGAAACCACTCCTA
GTCGGATTGGCACTCCGCGAACAACTGTTGGAGAAGGAAAGAATTCCCATCGACAAGCACGATTGGTCGATGGAC
TTTATCGTTACTCCGGACGAAGTTCTGACTAATTCTTCCCCCGTTTCATTTGATGCCTCAGAAAATGCAGGTTGA
Gene >Agabi119p4|109640
ATGTCCACAATTCAATCTTTGAAGATTCAAAAAAGGGCTTTGCGCAAGGCAATTGGCTCTAAGCTGTCCGCTATA
CCCACACAGTCAATTCAAGAACAATGTAATGTGGCATCGCTTTTCTCTCGCCTGCCTGGATGACATGCGGATTCG
ACAACAGCGTACTCGATCATCCAACATTTGGGGTCCTTCCCCGCGTTTAGCCGTTCAAAATCGCTTAGCTGCTAT
CTCAGCATGCCCTCGGGAGAGGTTGACACGTCTTCCCTGGTGTCCGAAATACTCGACTCAGGTGGGATCCTGTGC
GGAATGATATTCATATTTGACAATGTAAATCAAGGTAGGACCCTCTTCGTACCCAAAATCACAAACAGATCTGGA
GAAATGGAATTCTTGAAATTGTACGGTAAGGCTGACCTCGCAAGTCTCCCCAATGGGGTATGGGGAATCAAGGAG
CCGGACTCCGATTGGCAGGGTCAACCACGTGCGAAAGGTGAATTATCCACCAGCCTGTGGCATGGCATACCAAAT
GGACTAAATATTTGTGTGGTTCTATTTCTTCCAAGCGCTCGAAACCTCAGAATTGGATCTCATTCTCCTCCCAGC
TGTTGCGTTTGATAGAAACTTTGCGCGGCTTGGGCATGGTAAAGGATATTATGATCGTTTCATCACAAAATATCA
AACAACGTTTCATAAGAAACCACTCCTAGGTGCGTGCCCAGCAATGCCTTCTATGATCGATGATCAAGAAAACTA
TCCTTTCTTTCGATTAGTCGGATTGGCACTCCGCGAACAACTGTTGGAGAAGGAAAGAATTCCCATCGACAAGCA
CGATTGGTCGATGGACTTTATCGTTACTCCGGACGAAGTTCTGACTAATTCTTCCCCCGTTTCATTTGATGCCTC
AGAAAATGCAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail