Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|109590
Gene name
Locationscaffold_08:770721..771497
Strand-
Gene length (bp)776
Transcript length (bp)330
Coding sequence length (bp)330
Protein length (aa) 110

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain 2.2E-29 22 94
PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain 2.7E-10 23 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC19 PE=1 SV=1 8 105 8.0E-30
sp|Q09177|RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc19 PE=2 SV=1 8 90 1.0E-28
sp|Q5XK67|RPAC2_XENLA DNA-directed RNA polymerases I and III subunit RPAC2 OS=Xenopus laevis GN=polr1d PE=3 SV=1 1 93 1.0E-23
sp|Q9Y2S0|RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens GN=POLR1D PE=1 SV=1 3 93 3.0E-22
sp|Q1RMG8|RPAC2_BOVIN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Bos taurus GN=POLR1D PE=2 SV=1 3 93 7.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC19 PE=1 SV=1 8 105 8.0E-30
sp|Q09177|RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc19 PE=2 SV=1 8 90 1.0E-28
sp|Q5XK67|RPAC2_XENLA DNA-directed RNA polymerases I and III subunit RPAC2 OS=Xenopus laevis GN=polr1d PE=3 SV=1 1 93 1.0E-23
sp|Q9Y2S0|RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens GN=POLR1D PE=1 SV=1 3 93 3.0E-22
sp|Q1RMG8|RPAC2_BOVIN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Bos taurus GN=POLR1D PE=2 SV=1 3 93 7.0E-22
sp|P97304|RPAC2_MOUSE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Mus musculus GN=Polr1d PE=1 SV=1 9 94 1.0E-21
sp|Q6DRI4|RPAC2_DANRE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Danio rerio GN=polr1d PE=3 SV=1 9 93 4.0E-21
sp|Q54ES6|RPC19_DICDI DNA-directed RNA polymerases I and III subunit rpc19 OS=Dictyostelium discoideum GN=rpc19 PE=3 SV=1 22 91 1.0E-19
sp|Q9VIZ0|RPAC2_DROME Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Drosophila melanogaster GN=l(2)37Cg PE=3 SV=1 20 94 6.0E-15
sp|Q61IX2|RPAC2_CAEBR Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis briggsae GN=rpac-19 PE=3 SV=1 5 91 1.0E-14
sp|Q9VJE4|RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster GN=Rpb11 PE=3 SV=1 20 102 3.0E-14
sp|Q9XVH6|RPB11_CAEEL Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis elegans GN=rpb-11 PE=3 SV=1 20 108 4.0E-14
sp|P34476|RPAC2_CAEEL Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis elegans GN=rpac-19 PE=3 SV=1 5 91 2.0E-13
sp|O08740|RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus GN=Polr2j PE=1 SV=1 20 102 2.0E-13
sp|Q60SM4|RPB11_CAEBR Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis briggsae GN=rpb-11 PE=3 SV=1 20 108 2.0E-13
sp|P52435|RPB11_HUMAN DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens GN=POLR2J PE=1 SV=1 20 102 4.0E-13
sp|Q32P79|RPB11_BOVIN DNA-directed RNA polymerase II subunit RPB11 OS=Bos taurus GN=POLR2J PE=3 SV=1 20 102 4.0E-13
sp|Q7PVQ9|RPB11_ANOGA DNA-directed RNA polymerase II subunit RPB11 OS=Anopheles gambiae GN=Rpb11 PE=3 SV=2 20 102 6.0E-13
sp|Q9GZM3|RPB1B_HUMAN DNA-directed RNA polymerase II subunit RPB11-b1 OS=Homo sapiens GN=POLR2J2 PE=1 SV=2 20 107 6.0E-13
sp|Q9H1A7|RPB1C_HUMAN DNA-directed RNA polymerase II subunit RPB11-b2 OS=Homo sapiens GN=POLR2J3 PE=3 SV=1 20 107 2.0E-12
sp|P46217|RPOL_SULAC DNA-directed RNA polymerase subunit L OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoL PE=3 SV=1 24 83 4.0E-11
sp|Q86JJ5|RPB11_DICDI DNA-directed RNA polymerase II subunit rpb11 OS=Dictyostelium discoideum GN=polr2j PE=3 SV=1 20 85 7.0E-09
sp|Q38859|NRPBB_ARATH DNA-directed RNA polymerases II, IV and V subunit 11 OS=Arabidopsis thaliana GN=NRPB11 PE=1 SV=1 19 86 9.0E-09
sp|Q96YA7|RPOL_SULTO DNA-directed RNA polymerase subunit L OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoL PE=3 SV=1 24 83 1.0E-08
sp|Q4YZZ7|RPB11_PLABA Probable DNA-directed RNA polymerase II subunit RPB11 OS=Plasmodium berghei (strain Anka) GN=PB000758.01.0 PE=3 SV=1 24 67 1.0E-06
sp|P87123|RPB11_SCHPO DNA-directed RNA polymerase II subunit RPB11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb11 PE=1 SV=1 6 105 1.0E-06
sp|Q4XS21|RPB11_PLACH Probable DNA-directed RNA polymerase II subunit RPB11 OS=Plasmodium chabaudi GN=PC000833.03.0 PE=3 SV=1 24 82 3.0E-06
sp|Q980K0|RPOL_SULSO DNA-directed RNA polymerase subunit L OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoL PE=1 SV=1 24 85 4.0E-06
sp|Q8IER7|RPB11_PLAF7 Probable DNA-directed RNA polymerase II subunit RPB11 OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0023 PE=3 SV=1 24 67 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0009059 macromolecule biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901360 organic cyclic compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0019438 aromatic compound biosynthetic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0097747 RNA polymerase activity No
GO:0016779 nucleotidyltransferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0044237 cellular metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0003824 catalytic activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016070 RNA metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0005515 protein binding No
GO:0034654 nucleobase-containing compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|109590
MAAESVPKIKLLEGASADLSAATFQIHDESHTMGNALRWMLMKNPKVEFCGYSVPHPSENVINVRIQMYDNISSF
DALISALDNLDHLCETTLMARRWHHGIYSLTISR*
Coding >Agabi119p4|109590
ATGGCGGCGGAGTCAGTCCCAAAAATCAAATTGCTTGAAGGCGCTAGTGCGGACCTCTCGGCAGCGACCTTCCAG
ATTCACGATGAATCCCACACAATGGGTAATGCTCTCAGATGGATGCTTATGAAAAATCCTAAAGTGGAATTCTGC
GGATACAGTGTTCCCCATCCTTCGGAAAACGTCATCAATGTTCGGATTCAGATGTACGATAATATATCATCCTTT
GATGCTCTCATATCTGCTCTTGACAATCTGGACCACCTTTGCGAAACAACATTGATGGCTCGTCGCTGGCATCAT
GGTATCTATTCATTAACCATCTCTCGCTGA
Transcript >Agabi119p4|109590
ATGGCGGCGGAGTCAGTCCCAAAAATCAAATTGCTTGAAGGCGCTAGTGCGGACCTCTCGGCAGCGACCTTCCAG
ATTCACGATGAATCCCACACAATGGGTAATGCTCTCAGATGGATGCTTATGAAAAATCCTAAAGTGGAATTCTGC
GGATACAGTGTTCCCCATCCTTCGGAAAACGTCATCAATGTTCGGATTCAGATGTACGATAATATATCATCCTTT
GATGCTCTCATATCTGCTCTTGACAATCTGGACCACCTTTGCGAAACAACATTGATGGCTCGTCGCTGGCATCAT
GGTATCTATTCATTAACCATCTCTCGCTGA
Gene >Agabi119p4|109590
ATGGCGGCGGAGTCAGTCCCAAAAATCAAATTGGTGAGCTCTCCTCTTGCTCTCCTCTTGCTTACTGTCTGAGCT
TTAAGTGTCTACGTTTCGACTTTAGCTTGAAGGCGCTAGTGCGGACCTCTCGGCAGCGACCTTCCAGATTCACGA
TGAATCCCACACAATGGGTAATGCTCTCAGATGGATGCTTATGAAAAAGTGCGCCACTACTTGTCTTTGACAACT
TTTATGATGTACTGACTCGAGGTGAAGTCCTAAAGTGGAATTCTGCGGATACAGGTGATTTATTGGTTTATTATG
GCCCCATTGTTTTCCGTGGAACCATTTTTACTCCATTGAAGCTTCCATGCGACAACTGCGGAAATCTCACTGTGT
ATCTTGTTCCATTACCGGAAATCTGACTCATGTCGTTTTTGTTCACAGTGTTCCCCATCCTTCGGAAAACGTCAT
CAATGTTCGGATTCAGATGTACGGTGAGTCCCTTCCATCGTCACTCCACAATTCCTCGCGGCCTGATTGGAAGTA
ACAATTTTTAGATAATATATCATCCTTTGATGCTCTCATATCTGCTCTTGACAATCTGGACCACCTTTGCGAGTC
TATCGAGGATGCATATCTGGAGAGTCTACGGGCTGGCCGGTTTGAACGCTGGGAAGAACAACATTGATGGCTCGT
CGCTGGCATCATGGTATCTATTCATTGTATGTATACAATATTTTTCGTATCTTATCGAATGATACATGTGTTCTC
TCCTCTGCAGAACCATCTCTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail