Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|109500
Gene name
Locationscaffold_08:745342..746599
Strand+
Gene length (bp)1257
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 2.1E-47 211 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P81054|PLMP_GRIFR Peptidyl-Lys metalloendopeptidase OS=Grifola frondosa GN=MEP PE=1 SV=2 1 347 1.0E-121
sp|Q9Y7F7|PLMP_ARMME Peptidyl-Lys metalloendopeptidase OS=Armillaria mellea GN=MEP PE=1 SV=1 1 347 1.0E-119
sp|P81055|PLMP_PLEOS Peptidyl-Lys metalloendopeptidase OS=Pleurotus ostreatus GN=MEP PE=1 SV=1 180 345 5.0E-72
sp|O05485|EPRA1_AERHY Extracellular protease OS=Aeromonas hydrophila GN=eprA1 PE=3 SV=1 38 347 6.0E-46
sp|C5P507|MEP3_COCP7 Neutral protease 2 homolog MEP3 OS=Coccidioides posadasii (strain C735) GN=MEP3 PE=3 SV=1 36 340 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P81054|PLMP_GRIFR Peptidyl-Lys metalloendopeptidase OS=Grifola frondosa GN=MEP PE=1 SV=2 1 347 1.0E-121
sp|Q9Y7F7|PLMP_ARMME Peptidyl-Lys metalloendopeptidase OS=Armillaria mellea GN=MEP PE=1 SV=1 1 347 1.0E-119
sp|P81055|PLMP_PLEOS Peptidyl-Lys metalloendopeptidase OS=Pleurotus ostreatus GN=MEP PE=1 SV=1 180 345 5.0E-72
sp|O05485|EPRA1_AERHY Extracellular protease OS=Aeromonas hydrophila GN=eprA1 PE=3 SV=1 38 347 6.0E-46
sp|C5P507|MEP3_COCP7 Neutral protease 2 homolog MEP3 OS=Coccidioides posadasii (strain C735) GN=MEP3 PE=3 SV=1 36 340 2.0E-17
sp|C4JLQ3|NPIIA_UNCRE Neutral protease 2 homolog UREG_03761 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_03761 PE=3 SV=1 8 340 2.0E-17
sp|C5PE18|MEP6_COCP7 Neutral protease 2 homolog MEP6 OS=Coccidioides posadasii (strain C735) GN=MEP6 PE=3 SV=1 8 340 4.0E-17
sp|C4JK49|NPIIB_UNCRE Neutral protease 2 homolog UREG_02006 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_02006 PE=3 SV=1 28 340 5.0E-17
sp|C5NZY5|MEP5_COCP7 Neutral protease 2 homolog MEP5 OS=Coccidioides posadasii (strain C735) GN=MEP5 PE=3 SV=2 31 340 9.0E-16
sp|C5JHY1|NPIIB_AJEDS Neutral protease 2 homolog BDBG_02110 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_02110 PE=3 SV=1 8 340 8.0E-15
sp|C5NZL6|MEP8_COCP7 Neutral protease 2 homolog MEP8 OS=Coccidioides posadasii (strain C735) GN=MEP8 PE=3 SV=1 8 340 3.0E-13
sp|B0Y4X9|NPIIB_ASPFC Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_070680 PE=3 SV=1 13 344 2.0E-11
sp|D4AXC1|NPIIE_ARTBC Probable neutral protease 2 homolog ARB_00849 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00849 PE=3 SV=1 36 340 2.0E-11
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 36 340 3.0E-11
sp|E3QWD3|NPIIA_COLGM Neutral protease 2 homolog MGG_10927 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_10315 PE=3 SV=1 2 341 3.0E-11
sp|Q2UP30|NPIIA_ASPOR Neutral protease 2 homolog AO090001000135 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090001000135 PE=3 SV=1 35 340 7.0E-11
sp|Q4WQR6|NPIIA_ASPFU Neutral protease 2 homolog AFUA_4G13750 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G13750 PE=3 SV=1 13 340 1.0E-10
sp|B8NJB2|NPIIA_ASPFN Neutral protease 2 homolog AFLA_065450 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_065450 PE=3 SV=1 20 340 2.0E-10
sp|C5FR79|NPIIA_ARTOC Probable neutral protease 2 homolog MCYG_05201 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05201 PE=3 SV=1 36 340 3.0E-10
sp|E4UUX3|NPIIA_ARTGP Neutral protease 2 homolog MGYG_04094 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_04094 PE=3 SV=1 36 340 5.0E-10
sp|D4B639|NPIID_ARTBC Probable neutral protease 2 homolog ARB_03949 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03949 PE=3 SV=1 36 340 8.0E-10
sp|Q2KH28|NPIIA_MAGO7 Neutral protease 2 homolog MGG_10927 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGCH7_ch7g157 PE=3 SV=1 8 341 1.0E-09
sp|A1CVX6|NPIIB_NEOFI Neutral protease 2 homolog NFIA_102630 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_102630 PE=3 SV=1 18 344 1.0E-09
sp|D4D616|NPIID_TRIVH Probable neutral protease 2 homolog TRV_02539 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02539 PE=3 SV=1 36 340 1.0E-09
sp|D4AJ87|NPIIF_ARTBC Neutral protease 2 homolog ARB_04336 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04336 PE=3 SV=1 31 340 1.0E-09
sp|C5FPC2|NPIIC_ARTOC Probable neutral protease 2 homolog MCYG_04257 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04257 PE=3 SV=1 10 340 2.0E-09
sp|C5PIJ9|MEP4_COCP7 Neutral protease 2 homolog MEP4 OS=Coccidioides posadasii (strain C735) GN=MEP4 PE=3 SV=1 36 340 2.0E-09
sp|Q0UCJ2|NPIIA_PHANO Neutral protease 2 homolog SNOG_10522 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_10522 PE=3 SV=1 36 340 2.0E-09
sp|D4DGR5|NPIIC_TRIVH Probable neutral protease 2 homolog TRV_06370 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06370 PE=3 SV=1 36 340 3.0E-09
sp|D4AM79|NPIIC_ARTBC Probable neutral protease 2 homolog ARB_04769 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04769 PE=3 SV=1 36 340 3.0E-09
sp|C5PE62|MEP2_COCP7 Neutral protease 2 homolog MEP2 OS=Coccidioides posadasii (strain C735) GN=MEP2 PE=3 SV=1 13 344 3.0E-09
sp|C0IPP1|NPIIA_TRIRU Probable neutral protease 2 homolog A OS=Trichophyton rubrum GN=NpII-A PE=3 SV=1 36 340 4.0E-09
sp|Q09016|MEP20_ASPFM Neutral protease 2 homolog mep20 OS=Neosartorya fumigata GN=mep20 PE=3 SV=1 13 344 1.0E-08
sp|C5FIT1|NPIIE_ARTOC Probable neutral protease 2 homolog MCYG_01991 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_01991 PE=3 SV=1 36 340 2.0E-08
sp|D4D7X4|NPIIF_TRIVH Neutral protease 2 homolog TRV_03208 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03208 PE=3 SV=1 31 340 2.0E-08
sp|Q0CMZ3|NPIIA_ASPTN Neutral protease 2 homolog ATEG_04941 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_04941 PE=3 SV=1 35 340 3.0E-08
sp|E4UR63|NPIIC_ARTGP Neutral protease 2 homolog MGYG_02351 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02351 PE=3 SV=1 36 340 7.0E-08
sp|B0YEV0|NPIIA_ASPFC Neutral protease 2 homolog AFUB_100460 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_100460 PE=3 SV=2 35 340 7.0E-08
sp|C5G8P3|NPIIA_AJEDR Neutral protease 2 homolog BDCG_00922 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_00922 PE=3 SV=1 24 340 8.0E-08
sp|C5JKQ0|NPIIA_AJEDS Neutral protease 2 homolog BDBG_03102 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_03102 PE=3 SV=1 24 340 8.0E-08
sp|Q0V1D7|NPIIB_PHANO Neutral protease 2 homolog SNOG_02177 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_02177 PE=3 SV=1 35 346 2.0E-07
sp|E4US45|NPIID_ARTGP Neutral protease 2 homolog MGYG_03465 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03465 PE=3 SV=1 36 340 2.0E-07
sp|P47189|PLNC_PENCI Penicillolysin OS=Penicillium citrinum GN=plnC PE=1 SV=1 35 340 5.0E-07
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 35 340 8.0E-07
sp|C5FWQ2|NPIID_ARTOC Probable neutral protease 2 homolog MCYG_07155 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_07155 PE=3 SV=1 35 340 9.0E-07
sp|A1DA48|NPIIA_NEOFI Neutral protease 2 homolog NFIA_031120 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_031120 PE=3 SV=1 35 340 1.0E-06
sp|E5R1Z3|NPIIB_ARTGP Neutral protease 2 homolog MGYG_00813 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00813 PE=3 SV=1 35 340 2.0E-06
sp|A7F811|NPIIA_SCLS1 Neutral protease 2 homolog SS1G_13741 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13741 PE=3 SV=1 44 340 4.0E-06
sp|E4UYQ9|NPIIF_ARTGP Neutral protease 2 homolog MGYG_06241 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_06241 PE=3 SV=1 12 341 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0008237 metallopeptidase activity No
GO:0004175 endopeptidase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|109500
MFSFTVRSALFAIAASAAFVNAAPSISLKVTGSDSMSSVGDLKVTATVTNTGDETVKLLNDPHSPLSTLPADTFD
ISSDANGARPSFSGIKAKYVPEVAAARKAFTTLAPGQSIEVVHDLSEAYSFNEVNEGSYAIKARNLFYLVDDSAK
VTPIHATTEAHTARLSGNLSTTRPTIQKRASYVGCTASEQSILVSAASAAQNYASGARSYLQSHTSSSSRFTTWF
GTYTSSHHNTVLDHFSKISSNDFSSYTYDCTCNDAGVFAFVFPDQFGTVHLCPVFWQVPTTGTDSRGGTLVHESS
HFTANGGTDDHVYGQSGCKQLASSNSNQAIDNADSHEYFAENNPAQS*
Coding >Agabi119p4|109500
ATGTTCTCTTTCACCGTTCGTTCTGCTTTATTCGCGATTGCTGCCTCTGCCGCTTTTGTCAATGCGGCTCCTAGC
ATTTCGCTGAAGGTCACAGGTTCCGACTCAATGAGCTCCGTTGGAGACCTCAAAGTAACGGCGACTGTCACGAAC
ACCGGCGACGAAACCGTCAAGTTGCTCAATGATCCGCACTCTCCTCTTTCTACCCTGCCAGCCGATACTTTCGAT
ATTAGTTCAGATGCCAATGGTGCCCGCCCCTCCTTCTCTGGCATCAAGGCAAAATACGTTCCCGAAGTTGCTGCT
GCCAGGAAGGCATTCACTACACTTGCTCCTGGGCAATCTATCGAAGTTGTGCATGATTTGTCGGAGGCTTATAGT
TTCAATGAAGTTAATGAAGGATCATACGCCATCAAAGCTCGTAATCTCTTTTACCTCGTCGACGATTCAGCCAAA
GTCACGCCCATACACGCCACGACCGAGGCACACACTGCCCGCCTCTCAGGCAATCTTAGTACTACCCGACCAACC
ATTCAAAAAAGAGCCAGCTATGTTGGTTGCACCGCCTCCGAGCAAAGCATCCTCGTTTCTGCGGCTTCTGCAGCG
CAGAACTACGCCTCAGGAGCACGCTCATATCTCCAATCTCATACCTCGTCATCATCCCGCTTTACCACATGGTTT
GGGACATACACCTCATCCCATCACAACACTGTCTTGGATCATTTCTCAAAAATCAGCAGCAACGATTTCTCTTCT
TACACATATGACTGTACTTGCAATGATGCTGGCGTCTTCGCATTCGTGTTTCCCGATCAGTTCGGCACTGTGCAC
CTTTGCCCCGTTTTCTGGCAAGTTCCCACCACCGGTACCGACTCTCGGGGTGGAACTCTGGTCCACGAGTCTTCT
CACTTCACCGCCAACGGTGGAACCGATGACCATGTCTATGGTCAATCCGGCTGTAAACAACTCGCCAGCTCTAAT
TCTAATCAAGCTATCGATAATGCTGATTCACATGAATACTTTGCGGAGAACAACCCAGCTCAGTCGTAG
Transcript >Agabi119p4|109500
ATGTTCTCTTTCACCGTTCGTTCTGCTTTATTCGCGATTGCTGCCTCTGCCGCTTTTGTCAATGCGGCTCCTAGC
ATTTCGCTGAAGGTCACAGGTTCCGACTCAATGAGCTCCGTTGGAGACCTCAAAGTAACGGCGACTGTCACGAAC
ACCGGCGACGAAACCGTCAAGTTGCTCAATGATCCGCACTCTCCTCTTTCTACCCTGCCAGCCGATACTTTCGAT
ATTAGTTCAGATGCCAATGGTGCCCGCCCCTCCTTCTCTGGCATCAAGGCAAAATACGTTCCCGAAGTTGCTGCT
GCCAGGAAGGCATTCACTACACTTGCTCCTGGGCAATCTATCGAAGTTGTGCATGATTTGTCGGAGGCTTATAGT
TTCAATGAAGTTAATGAAGGATCATACGCCATCAAAGCTCGTAATCTCTTTTACCTCGTCGACGATTCAGCCAAA
GTCACGCCCATACACGCCACGACCGAGGCACACACTGCCCGCCTCTCAGGCAATCTTAGTACTACCCGACCAACC
ATTCAAAAAAGAGCCAGCTATGTTGGTTGCACCGCCTCCGAGCAAAGCATCCTCGTTTCTGCGGCTTCTGCAGCG
CAGAACTACGCCTCAGGAGCACGCTCATATCTCCAATCTCATACCTCGTCATCATCCCGCTTTACCACATGGTTT
GGGACATACACCTCATCCCATCACAACACTGTCTTGGATCATTTCTCAAAAATCAGCAGCAACGATTTCTCTTCT
TACACATATGACTGTACTTGCAATGATGCTGGCGTCTTCGCATTCGTGTTTCCCGATCAGTTCGGCACTGTGCAC
CTTTGCCCCGTTTTCTGGCAAGTTCCCACCACCGGTACCGACTCTCGGGGTGGAACTCTGGTCCACGAGTCTTCT
CACTTCACCGCCAACGGTGGAACCGATGACCATGTCTATGGTCAATCCGGCTGTAAACAACTCGCCAGCTCTAAT
TCTAATCAAGCTATCGATAATGCTGATTCACATGAATACTTTGCGGAGAACAACCCAGCTCAGTCGTAG
Gene >Agabi119p4|109500
ATGTTCTCTTTCACCGTTCGTTCTGCTTTATTCGCGATTGCTGCCTCTGCCGCTTTTGTCAATGCGGCTCCTAGC
ATTTCGCTGAAGGTCACAGGTATGAGTATGACATACTATGGTGACGCGATTCATAACGGTACCCAGGTTCCGACT
CAATGAGCTCCGTTGGAGACCTCAAAGTAACGGCGACTGTCACGAACACCGGCGACGAAACCGTCAAGTTGCTCA
ATGATCCGCACTCTCCTCTTTCTACCCTGCCAGCCGATACTTTCGATATTAGTTCAGATGCCAATGGTGCCCGCC
CCTCCTTCTCTGGCATCAAGGCAAAATACGTTCCCGAAGTTGCTGCTGCCAGGAAGGCATTCACTACACTTGCTC
CTGGGCAATCTATCGAAGTTGTGCATGATTGTGAGTGTCTAACATAGTGGTGAATTAATCAACTCATATGGACGG
TTCGCAGTGTCGGAGGCTTATAGTTTCAATGAAGTTAATGAAGGATCATACGCCATCAAAGCTCGTAATCTCTTT
TACCTCGTCGACGATTCAGCCAAAGTCACGCCCATACACGCCACGACCGAGGCACACACTGCCCGCCTCTCAGGC
AATCTTAGTACTACCCGACCAACCATTCAAAAAAGAGCCAGCTATGTTGGTTGCACCGCCTCCGAGCAAAGCATC
CTCGTTTCTGCGGCTTCTGCAGCGCAGAACTACGCCTCAGGAGCACGCTCATATCTCCAATCTCATACCTCGTCA
TCATCCCGCTTTACCACATGGTTTGGGACATACACCTCATCCCATCACAACACTGTCTTGGATCATTTCTCAAAA
ATCAGCAGCAACGATTTCTCTTCTTACACATATGACTGTACTTGCAATGATGCTGGCGTCTTCGCATTCGTGTTT
CCCGATCAGTAAGAATGTTCATTTGCCGTGATCTTTCCATATCAACCGATCTTCCTCTGTAGGTTCGGCACTGTG
CACCTTTGCCCCGTTTTCTGGCAAGTTCCCACCACCGGTACCGACTCTCGGGTGAGTTTTTGATTCTCCAAAACT
TTAAGCTCGTCGGAGAACTTACGGACCGCATGCTAGGGTGGAACTCTGGTCCACGAGTCTTCTCACTTCACCGCC
AACGGTGGAACCGATGACCATGTCTATGGTCAATCCGGCTGTAAACAACTCGCCAGCTCTAATTCTAATCAAGCT
ATCGATAATGCTGATTCACATGAATACTTTGCGGAGAACAACCCAGCTCAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail