Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|109450
Gene name
Locationscaffold_08:728050..729030
Strand+
Gene length (bp)980
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25 3.2E-53 23 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25310|LYSM1_STRGL Lysozyme M1 OS=Streptomyces globisporus GN=acm PE=1 SV=1 21 223 3.0E-72
sp|D4ANU4|LYS_ARTBC N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05911 PE=1 SV=1 21 225 3.0E-66
sp|P00721|LYS_CHASP N,O-diacetylmuramidase OS=Chalaropsis sp. PE=1 SV=1 21 225 5.0E-65
sp|Q8FFY2|YEGX_ECOL6 Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yegX PE=3 SV=2 7 219 1.0E-19
sp|P34020|LYS_CLOAB Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lyc PE=1 SV=1 21 207 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25310|LYSM1_STRGL Lysozyme M1 OS=Streptomyces globisporus GN=acm PE=1 SV=1 21 223 3.0E-72
sp|D4ANU4|LYS_ARTBC N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05911 PE=1 SV=1 21 225 3.0E-66
sp|P00721|LYS_CHASP N,O-diacetylmuramidase OS=Chalaropsis sp. PE=1 SV=1 21 225 5.0E-65
sp|Q8FFY2|YEGX_ECOL6 Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yegX PE=3 SV=2 7 219 1.0E-19
sp|P34020|LYS_CLOAB Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lyc PE=1 SV=1 21 207 3.0E-19
sp|P76421|YEGX_ECOLI Uncharacterized protein YegX OS=Escherichia coli (strain K12) GN=yegX PE=3 SV=2 7 219 1.0E-18
sp|P26836|LYS_CLOPE Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) GN=lyc PE=3 SV=2 21 181 7.0E-18
sp|Q8X7H0|YEGX_ECO57 Uncharacterized protein YegX OS=Escherichia coli O157:H7 GN=yegX PE=3 SV=2 7 219 1.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0009253 peptidoglycan catabolic process Yes
GO:0016998 cell wall macromolecule catabolic process Yes
GO:0003796 lysozyme activity Yes
GO:0016787 hydrolase activity No
GO:0044265 cellular macromolecule catabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0061783 peptidoglycan muralytic activity No
GO:0009056 catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000270 peptidoglycan metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0009987 cellular process No
GO:0006022 aminoglycan metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044248 cellular catabolic process No
GO:0003824 catalytic activity No
GO:0044036 cell wall macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0044237 cellular metabolic process No
GO:0030203 glycosaminoglycan metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0008150 biological_process No
GO:0006026 aminoglycan catabolic process No
GO:0006027 glycosaminoglycan catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|109450
MKWLSVLALALPATVYAAMPKGIDVSSHQPSINWNTVKANGIEFAYIKATEGTGYINPEFSSQYTGATNVGIIRG
GYHFARPDISSGATQANFFLAHGGGWSADGITLPGALDIEYNPYGATCFGLSASAMTSWIKDFSNTYRSRTGRYP
VIYTTTDWWRTCTGNASGFQNDNPLWIASWGSSIGTLPAGYQFTTFWQYANSGPNPGDQDYFNGDAAGLLRMARG
S*
Coding >Agabi119p4|109450
ATGAAGTGGTTGTCTGTTCTTGCTCTCGCTCTTCCCGCAACCGTCTATGCAGCGATGCCCAAGGGTATTGATGTC
TCTAGTCATCAACCCAGCATCAATTGGAACACGGTTAAGGCGAACGGTATTGAATTTGCCTACATCAAAGCTACG
GAGGGCACCGGCTATATTAACCCTGAGTTCAGTTCCCAGTACACGGGCGCGACCAATGTCGGTATCATCCGTGGT
GGATATCACTTTGCTCGCCCCGATATCTCTTCCGGTGCAACTCAAGCCAATTTTTTCTTGGCGCATGGTGGTGGT
TGGAGCGCTGACGGCATTACTCTTCCCGGTGCTCTTGACATTGAGTACAATCCCTACGGTGCTACCTGTTTTGGT
CTCAGCGCCTCGGCCATGACTTCTTGGATCAAGGATTTCTCTAACACTTACCGCTCAAGAACTGGTCGCTACCCT
GTCATCTATACGACCACTGATTGGTGGAGGACTTGCACTGGTAACGCCAGTGGTTTCCAGAATGACAACCCTCTG
TGGATTGCCAGTTGGGGTTCTAGCATTGGGACACTGCCTGCCGGCTACCAATTTACCACCTTCTGGCAATATGCC
AACTCCGGACCGAACCCGGGTGACCAAGATTATTTCAATGGTGATGCTGCTGGCCTCCTCCGTATGGCCAGAGGT
TCATAG
Transcript >Agabi119p4|109450
ATGAAGTGGTTGTCTGTTCTTGCTCTCGCTCTTCCCGCAACCGTCTATGCAGCGATGCCCAAGGGTATTGATGTC
TCTAGTCATCAACCCAGCATCAATTGGAACACGGTTAAGGCGAACGGTATTGAATTTGCCTACATCAAAGCTACG
GAGGGCACCGGCTATATTAACCCTGAGTTCAGTTCCCAGTACACGGGCGCGACCAATGTCGGTATCATCCGTGGT
GGATATCACTTTGCTCGCCCCGATATCTCTTCCGGTGCAACTCAAGCCAATTTTTTCTTGGCGCATGGTGGTGGT
TGGAGCGCTGACGGCATTACTCTTCCCGGTGCTCTTGACATTGAGTACAATCCCTACGGTGCTACCTGTTTTGGT
CTCAGCGCCTCGGCCATGACTTCTTGGATCAAGGATTTCTCTAACACTTACCGCTCAAGAACTGGTCGCTACCCT
GTCATCTATACGACCACTGATTGGTGGAGGACTTGCACTGGTAACGCCAGTGGTTTCCAGAATGACAACCCTCTG
TGGATTGCCAGTTGGGGTTCTAGCATTGGGACACTGCCTGCCGGCTACCAATTTACCACCTTCTGGCAATATGCC
AACTCCGGACCGAACCCGGGTGACCAAGATTATTTCAATGGTGATGCTGCTGGCCTCCTCCGTATGGCCAGAGGT
TCATAG
Gene >Agabi119p4|109450
ATGAAGTGGTTGTCTGTTCTTGCTCTCGCTCTTCCCGCAACCGTCTATGCAGCGATGCCCAAGGGTATTGATGTC
TCTAGTCATCAACCCAGCATCAATTGGAACACGGTTAAGGCGAACGGTATTGAATTTGCCTACATCAAAGCTACG
GAGGGCACCGGTCAGTACCTTAACAACTTTTGTTTTGTGTTGGCTGGGTCGCTGATTGCTGCACGTTTACATCTG
CAAAGGCTATATTAACCCTGAGTTCAGTTCCCAGTACACGTCAGTAATAACCTGTATTCGTCACACCCTTTCGTT
GCTAATTATGATTGTAGGGGCGCGACCAATGTCGGTATCATCCGTGGTGGATATCACTTTGCTCGCCCCGATATC
TCTTCCGGTGCAACTCAAGCCAATTTTTTCTTGGCGCATGGTGGTGGTTGGAGCGCTGACGGCATTACTCTTCCC
GGTGCTCTTGACATTGAGTGTGAGTTGGTTCAGGCATAGTTGTTAACAGTGATCCAACTTATTTTTGTTACTCGC
AGACAATCCCTACGGTGCTACCTGTTTTGGTCTCAGCGCCTCGGCCATGACTTCTTGGATCAAGGATTTCTCTAA
CACTTACCGCTCAAGAACTGGTCGCTACCCTGTCATCTATACGACCACTGATTGGTGGAGGACTTGCACTGGTAA
CGCCAGTGGTTTCCAGAATGACAACCCTCTGTGGATTGCCAGTTGGGGTTCTAGCATTGGGACACTGCCTGCCGG
CTACCAGTGAGTCAATTTCGATCCGCAGTTCGCAGTTGGGTTTCCTGATCCGAATTGCCTCGCGCAGATTTACCA
CCTTCTGGCAATATGCCAACTCCGGACCGAACCCGGGTGACCAAGATTATTTCAATGGTGATGCTGCTGGCCTCC
TCCGGTATGATTTTTCTTGGACGGGCATTGGATTATGGCTAATTTCTCGGATTTTCAATAGTATGGCCAGAGGTT
CATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail