© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|107410 |
| Gene name | |
| Location | scaffold_08:261832..262777 |
| Strand | + |
| Gene length (bp) | 945 |
| Transcript length (bp) | 897 |
| Coding sequence length (bp) | 897 |
| Protein length (aa) | 299 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF03719 | Ribosomal_S5_C | Ribosomal protein S5, C-terminal domain | 3.6E-19 | 197 | 254 |
| PF00333 | Ribosomal_S5 | Ribosomal protein S5, N-terminal domain | 3.2E-13 | 123 | 182 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10234|RT05_SCHPO | Probable 37S ribosomal protein S5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp5 PE=1 SV=1 | 114 | 275 | 9.0E-34 |
| sp|P33759|RT05_YEAST | 37S ribosomal protein S5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS5 PE=1 SV=1 | 124 | 298 | 2.0E-20 |
| sp|Q99N87|RT05_MOUSE | 28S ribosomal protein S5, mitochondrial OS=Mus musculus GN=Mrps5 PE=1 SV=1 | 123 | 278 | 1.0E-19 |
| sp|P82675|RT05_HUMAN | 28S ribosomal protein S5, mitochondrial OS=Homo sapiens GN=MRPS5 PE=1 SV=2 | 123 | 278 | 2.0E-19 |
| sp|Q5REJ1|RT05_PONAB | 28S ribosomal protein S5, mitochondrial OS=Pongo abelii GN=MRPS5 PE=2 SV=1 | 123 | 278 | 7.0E-19 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10234|RT05_SCHPO | Probable 37S ribosomal protein S5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp5 PE=1 SV=1 | 114 | 275 | 9.0E-34 |
| sp|P33759|RT05_YEAST | 37S ribosomal protein S5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS5 PE=1 SV=1 | 124 | 298 | 2.0E-20 |
| sp|Q99N87|RT05_MOUSE | 28S ribosomal protein S5, mitochondrial OS=Mus musculus GN=Mrps5 PE=1 SV=1 | 123 | 278 | 1.0E-19 |
| sp|P82675|RT05_HUMAN | 28S ribosomal protein S5, mitochondrial OS=Homo sapiens GN=MRPS5 PE=1 SV=2 | 123 | 278 | 2.0E-19 |
| sp|Q5REJ1|RT05_PONAB | 28S ribosomal protein S5, mitochondrial OS=Pongo abelii GN=MRPS5 PE=2 SV=1 | 123 | 278 | 7.0E-19 |
| sp|Q2KID9|RT05_BOVIN | 28S ribosomal protein S5, mitochondrial OS=Bos taurus GN=MRPS5 PE=1 SV=1 | 123 | 253 | 1.0E-17 |
| sp|B0U5L6|RS5_XYLFM | 30S ribosomal protein S5 OS=Xylella fastidiosa (strain M12) GN=rpsE PE=3 SV=1 | 116 | 260 | 2.0E-13 |
| sp|Q9PE59|RS5_XYLFA | 30S ribosomal protein S5 OS=Xylella fastidiosa (strain 9a5c) GN=rpsE PE=3 SV=1 | 116 | 282 | 3.0E-13 |
| sp|B4SKY0|RS5_STRM5 | 30S ribosomal protein S5 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsE PE=3 SV=1 | 116 | 259 | 3.0E-13 |
| sp|B2FQK1|RS5_STRMK | 30S ribosomal protein S5 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsE PE=3 SV=1 | 116 | 259 | 3.0E-13 |
| sp|Q87E65|RS5_XYLFT | 30S ribosomal protein S5 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsE PE=3 SV=1 | 116 | 260 | 6.0E-13 |
| sp|B2I8I6|RS5_XYLF2 | 30S ribosomal protein S5 OS=Xylella fastidiosa (strain M23) GN=rpsE PE=3 SV=1 | 116 | 260 | 6.0E-13 |
| sp|A1ALV8|RS5_PELPD | 30S ribosomal protein S5 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsE PE=3 SV=1 | 144 | 254 | 6.0E-13 |
| sp|A0L5Z0|RS5_MAGMM | 30S ribosomal protein S5 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsE PE=3 SV=1 | 144 | 254 | 7.0E-13 |
| sp|Q749A4|RS5_GEOSL | 30S ribosomal protein S5 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsE PE=3 SV=1 | 111 | 253 | 1.0E-12 |
| sp|B8G6Q8|RS5_CHLAD | 30S ribosomal protein S5 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsE PE=3 SV=1 | 144 | 253 | 2.0E-12 |
| sp|Q6MJ29|RS5_BDEBA | 30S ribosomal protein S5 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-12 |
| sp|Q4AAF7|RS5_MYCHJ | 30S ribosomal protein S5 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpsE PE=3 SV=1 | 144 | 253 | 2.0E-12 |
| sp|Q601J7|RS5_MYCH2 | 30S ribosomal protein S5 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpsE PE=3 SV=1 | 144 | 253 | 2.0E-12 |
| sp|Q4A8I8|RS5_MYCH7 | 30S ribosomal protein S5 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpsE PE=3 SV=1 | 144 | 253 | 2.0E-12 |
| sp|Q8EUD0|RS5_MYCPE | 30S ribosomal protein S5 OS=Mycoplasma penetrans (strain HF-2) GN=rpsE PE=3 SV=1 | 116 | 259 | 2.0E-12 |
| sp|B9LJE9|RS5_CHLSY | 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsE PE=3 SV=1 | 144 | 253 | 3.0E-12 |
| sp|A9WH83|RS5_CHLAA | 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsE PE=3 SV=1 | 144 | 253 | 3.0E-12 |
| sp|Q39XY9|RS5_GEOMG | 30S ribosomal protein S5 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsE PE=3 SV=1 | 111 | 254 | 3.0E-12 |
| sp|Q93425|RT05_CAEEL | Putative 28S ribosomal protein S5, mitochondrial OS=Caenorhabditis elegans GN=mrps-5 PE=3 SV=3 | 125 | 248 | 3.0E-12 |
| sp|Q2S929|RS5_HAHCH | 30S ribosomal protein S5 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsE PE=3 SV=1 | 144 | 259 | 4.0E-12 |
| sp|Q2W2K8|RS5_MAGSA | 30S ribosomal protein S5 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsE PE=3 SV=1 | 144 | 253 | 5.0E-12 |
| sp|Q5GWV1|RS5_XANOR | 30S ribosomal protein S5 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsE PE=3 SV=1 | 116 | 260 | 5.0E-12 |
| sp|B2SQS7|RS5_XANOP | 30S ribosomal protein S5 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsE PE=3 SV=1 | 116 | 260 | 5.0E-12 |
| sp|Q2P002|RS5_XANOM | 30S ribosomal protein S5 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsE PE=3 SV=1 | 116 | 260 | 5.0E-12 |
| sp|P66587|RS5_XANCP | 30S ribosomal protein S5 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsE PE=3 SV=1 | 116 | 260 | 5.0E-12 |
| sp|B0RU65|RS5_XANCB | 30S ribosomal protein S5 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsE PE=3 SV=1 | 116 | 260 | 5.0E-12 |
| sp|Q4URF6|RS5_XANC8 | 30S ribosomal protein S5 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsE PE=3 SV=1 | 116 | 260 | 5.0E-12 |
| sp|Q3BWW6|RS5_XANC5 | 30S ribosomal protein S5 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsE PE=3 SV=1 | 116 | 260 | 5.0E-12 |
| sp|P66586|RS5_XANAC | 30S ribosomal protein S5 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsE PE=3 SV=1 | 116 | 260 | 5.0E-12 |
| sp|Q1QDG9|RS5_PSYCK | 30S ribosomal protein S5 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsE PE=3 SV=1 | 129 | 262 | 5.0E-12 |
| sp|Q4FUD9|RS5_PSYA2 | 30S ribosomal protein S5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsE PE=3 SV=1 | 129 | 262 | 5.0E-12 |
| sp|Q2GL42|RS5_ANAPZ | 30S ribosomal protein S5 OS=Anaplasma phagocytophilum (strain HZ) GN=rpsE PE=3 SV=1 | 144 | 259 | 6.0E-12 |
| sp|A8Y3Q1|RT05_CAEBR | Putative 28S ribosomal protein S5, mitochondrial OS=Caenorhabditis briggsae GN=mrps-5 PE=3 SV=3 | 125 | 248 | 6.0E-12 |
| sp|Q31IW5|RS5_THICR | 30S ribosomal protein S5 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsE PE=3 SV=1 | 119 | 259 | 1.0E-11 |
| sp|Q4K550|RS5_PSEF5 | 30S ribosomal protein S5 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsE PE=3 SV=1 | 116 | 259 | 1.0E-11 |
| sp|Q3K605|RS5_PSEPF | 30S ribosomal protein S5 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsE PE=3 SV=1 | 116 | 259 | 1.0E-11 |
| sp|A4IZR7|RS5_FRATW | 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsE PE=3 SV=1 | 116 | 250 | 1.0E-11 |
| sp|Q5NHV1|RS5_FRATT | 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsE PE=3 SV=1 | 116 | 250 | 1.0E-11 |
| sp|Q0BNR0|RS5_FRATO | 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsE PE=3 SV=1 | 116 | 250 | 1.0E-11 |
| sp|A0Q4K0|RS5_FRATN | 30S ribosomal protein S5 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsE PE=3 SV=1 | 116 | 250 | 1.0E-11 |
| sp|A7N9U2|RS5_FRATF | 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsE PE=3 SV=1 | 116 | 250 | 1.0E-11 |
| sp|Q14JA3|RS5_FRAT1 | 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsE PE=3 SV=1 | 116 | 250 | 1.0E-11 |
| sp|C3K2V9|RS5_PSEFS | 30S ribosomal protein S5 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsE PE=3 SV=1 | 116 | 259 | 2.0E-11 |
| sp|Q2A5F3|RS5_FRATH | 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsE PE=3 SV=1 | 116 | 250 | 2.0E-11 |
| sp|A1KRJ0|RS5_NEIMF | 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsE PE=3 SV=1 | 119 | 260 | 2.0E-11 |
| sp|P66577|RS5_NEIMB | 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsE PE=3 SV=1 | 119 | 260 | 2.0E-11 |
| sp|P66576|RS5_NEIMA | 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsE PE=3 SV=1 | 119 | 260 | 2.0E-11 |
| sp|A9M3U9|RS5_NEIM0 | 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsE PE=3 SV=1 | 119 | 260 | 2.0E-11 |
| sp|Q5F5U4|RS5_NEIG1 | 30S ribosomal protein S5 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsE PE=3 SV=1 | 119 | 260 | 2.0E-11 |
| sp|B0V6W2|RS5_ACIBY | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AYE) GN=rpsE PE=3 SV=1 | 117 | 254 | 2.0E-11 |
| sp|B0VQT5|RS5_ACIBS | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain SDF) GN=rpsE PE=3 SV=1 | 117 | 254 | 2.0E-11 |
| sp|B2HZ91|RS5_ACIBC | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain ACICU) GN=rpsE PE=3 SV=1 | 117 | 254 | 2.0E-11 |
| sp|B7IA22|RS5_ACIB5 | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AB0057) GN=rpsE PE=3 SV=1 | 117 | 254 | 2.0E-11 |
| sp|B7GW19|RS5_ACIB3 | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsE PE=3 SV=1 | 117 | 254 | 2.0E-11 |
| sp|A3M967|RS5_ACIBT | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsE PE=3 SV=2 | 129 | 254 | 2.0E-11 |
| sp|A9IW04|RS5_BART1 | 30S ribosomal protein S5 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsE PE=3 SV=1 | 144 | 274 | 2.0E-11 |
| sp|B1LWQ9|RS5_METRJ | 30S ribosomal protein S5 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsE PE=3 SV=1 | 144 | 274 | 2.0E-11 |
| sp|Q07KN5|RS5_RHOP5 | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsE PE=3 SV=1 | 144 | 259 | 2.0E-11 |
| sp|Q6F7S9|RS5_ACIAD | 30S ribosomal protein S5 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsE PE=3 SV=1 | 129 | 254 | 3.0E-11 |
| sp|Q211G5|RS5_RHOPB | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsE PE=3 SV=1 | 144 | 259 | 3.0E-11 |
| sp|Q5WZJ5|RS5_LEGPL | 30S ribosomal protein S5 OS=Legionella pneumophila (strain Lens) GN=rpsE PE=3 SV=1 | 120 | 253 | 3.0E-11 |
| sp|Q5ZYM6|RS5_LEGPH | 30S ribosomal protein S5 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsE PE=3 SV=1 | 120 | 253 | 3.0E-11 |
| sp|A5IHP7|RS5_LEGPC | 30S ribosomal protein S5 OS=Legionella pneumophila (strain Corby) GN=rpsE PE=3 SV=1 | 120 | 253 | 3.0E-11 |
| sp|Q5X842|RS5_LEGPA | 30S ribosomal protein S5 OS=Legionella pneumophila (strain Paris) GN=rpsE PE=3 SV=1 | 120 | 253 | 3.0E-11 |
| sp|Q1QN13|RS5_NITHX | 30S ribosomal protein S5 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsE PE=3 SV=1 | 144 | 259 | 3.0E-11 |
| sp|B3QYE1|RS5_CHLT3 | 30S ribosomal protein S5 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rpsE PE=3 SV=1 | 111 | 254 | 3.0E-11 |
| sp|Q0BUN3|RS5_GRABC | 30S ribosomal protein S5 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-11 |
| sp|Q89JA1|RS5_BRADU | 30S ribosomal protein S5 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsE PE=3 SV=1 | 144 | 259 | 3.0E-11 |
| sp|A4YSK9|RS5_BRASO | 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsE PE=3 SV=2 | 144 | 259 | 3.0E-11 |
| sp|A5ELL0|RS5_BRASB | 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsE PE=3 SV=1 | 144 | 259 | 3.0E-11 |
| sp|A1AVL7|RS5_RUTMC | 30S ribosomal protein S5 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsE PE=3 SV=1 | 127 | 259 | 4.0E-11 |
| sp|Q134U6|RS5_RHOPS | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-11 |
| sp|B2IK79|RS5_BEII9 | 30S ribosomal protein S5 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-11 |
| sp|P66572|RS5_HELPY | 30S ribosomal protein S5 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsE PE=3 SV=2 | 129 | 253 | 4.0E-11 |
| sp|P66573|RS5_HELPJ | 30S ribosomal protein S5 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsE PE=3 SV=2 | 129 | 253 | 4.0E-11 |
| sp|Q2IXP3|RS5_RHOP2 | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-11 |
| sp|Q4ZMR1|RS5_PSEU2 | 30S ribosomal protein S5 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsE PE=3 SV=1 | 116 | 259 | 5.0E-11 |
| sp|Q889V4|RS5_PSESM | 30S ribosomal protein S5 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsE PE=3 SV=1 | 116 | 259 | 5.0E-11 |
| sp|Q488Z6|RS5_COLP3 | 30S ribosomal protein S5 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsE PE=3 SV=1 | 136 | 262 | 5.0E-11 |
| sp|A4VHP7|RS5_PSEU5 | 30S ribosomal protein S5 OS=Pseudomonas stutzeri (strain A1501) GN=rpsE PE=3 SV=1 | 116 | 259 | 5.0E-11 |
| sp|B3QBW3|RS5_RHOPT | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsE PE=3 SV=1 | 144 | 254 | 5.0E-11 |
| sp|Q6N4V0|RS5_RHOPA | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsE PE=1 SV=3 | 144 | 254 | 5.0E-11 |
| sp|Q493J1|RS5_BLOPB | 30S ribosomal protein S5 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsE PE=3 SV=1 | 125 | 259 | 6.0E-11 |
| sp|B2UV65|RS5_HELPS | 30S ribosomal protein S5 OS=Helicobacter pylori (strain Shi470) GN=rpsE PE=3 SV=1 | 129 | 253 | 6.0E-11 |
| sp|Q1CRV8|RS5_HELPH | 30S ribosomal protein S5 OS=Helicobacter pylori (strain HPAG1) GN=rpsE PE=3 SV=1 | 129 | 253 | 6.0E-11 |
| sp|B6JNE1|RS5_HELP2 | 30S ribosomal protein S5 OS=Helicobacter pylori (strain P12) GN=rpsE PE=3 SV=1 | 129 | 253 | 6.0E-11 |
| sp|B0T2D9|RS5_CAUSK | 30S ribosomal protein S5 OS=Caulobacter sp. (strain K31) GN=rpsE PE=3 SV=1 | 144 | 259 | 6.0E-11 |
| sp|Q1IFU9|RS5_PSEE4 | 30S ribosomal protein S5 OS=Pseudomonas entomophila (strain L48) GN=rpsE PE=3 SV=1 | 116 | 259 | 6.0E-11 |
| sp|Q3SSU9|RS5_NITWN | 30S ribosomal protein S5 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsE PE=3 SV=1 | 144 | 259 | 6.0E-11 |
| sp|A9H3L2|RS5_GLUDA | 30S ribosomal protein S5 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsE PE=3 SV=1 | 144 | 254 | 7.0E-11 |
| sp|A9W4S3|RS5_METEP | 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain PA1) GN=rpsE PE=3 SV=1 | 144 | 259 | 7.0E-11 |
| sp|B7L0T3|RS5_METC4 | 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsE PE=3 SV=1 | 144 | 259 | 7.0E-11 |
| sp|B1Z776|RS5_METPB | 30S ribosomal protein S5 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsE PE=3 SV=1 | 144 | 259 | 7.0E-11 |
| sp|Q48D53|RS5_PSE14 | 30S ribosomal protein S5 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsE PE=3 SV=1 | 116 | 259 | 7.0E-11 |
| sp|A1USR1|RS5_BARBK | 30S ribosomal protein S5 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsE PE=3 SV=1 | 144 | 284 | 7.0E-11 |
| sp|A7IPQ3|RS5_XANP2 | 30S ribosomal protein S5 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsE PE=3 SV=1 | 144 | 286 | 7.0E-11 |
| sp|Q7MYG8|RS5_PHOLL | 30S ribosomal protein S5 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsE PE=3 SV=1 | 125 | 259 | 7.0E-11 |
| sp|Q1LTC1|RS5_BAUCH | 30S ribosomal protein S5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsE PE=3 SV=1 | 109 | 259 | 8.0E-11 |
| sp|A7H0Z5|RS5_CAMC5 | 30S ribosomal protein S5 OS=Campylobacter curvus (strain 525.92) GN=rpsE PE=3 SV=1 | 129 | 253 | 8.0E-11 |
| sp|Q9A8T6|RS5_CAUCR | 30S ribosomal protein S5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsE PE=3 SV=1 | 144 | 259 | 8.0E-11 |
| sp|B8H4F1|RS5_CAUCN | 30S ribosomal protein S5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsE PE=3 SV=1 | 144 | 259 | 8.0E-11 |
| sp|A7HWS8|RS5_PARL1 | 30S ribosomal protein S5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsE PE=3 SV=1 | 144 | 280 | 8.0E-11 |
| sp|C1DKN0|RS5_AZOVD | 30S ribosomal protein S5 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsE PE=3 SV=1 | 116 | 259 | 8.0E-11 |
| sp|Q17ZC2|RS5_HELAH | 30S ribosomal protein S5 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsE PE=3 SV=1 | 129 | 253 | 8.0E-11 |
| sp|B1JAJ5|RS5_PSEPW | 30S ribosomal protein S5 OS=Pseudomonas putida (strain W619) GN=rpsE PE=3 SV=1 | 116 | 259 | 9.0E-11 |
| sp|Q88QL8|RS5_PSEPK | 30S ribosomal protein S5 OS=Pseudomonas putida (strain KT2440) GN=rpsE PE=3 SV=1 | 116 | 259 | 9.0E-11 |
| sp|B0KK84|RS5_PSEPG | 30S ribosomal protein S5 OS=Pseudomonas putida (strain GB-1) GN=rpsE PE=3 SV=1 | 116 | 259 | 9.0E-11 |
| sp|A5VXR4|RS5_PSEP1 | 30S ribosomal protein S5 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsE PE=3 SV=1 | 116 | 259 | 9.0E-11 |
| sp|Q6KI38|RS5_MYCMO | 30S ribosomal protein S5 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpsE PE=3 SV=1 | 144 | 254 | 9.0E-11 |
| sp|Q1GK12|RS5_RUEST | 30S ribosomal protein S5 OS=Ruegeria sp. (strain TM1040) GN=rpsE PE=3 SV=1 | 144 | 259 | 9.0E-11 |
| sp|Q1R0F8|RS5_CHRSD | 30S ribosomal protein S5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsE PE=3 SV=1 | 144 | 259 | 9.0E-11 |
| sp|Q5LW41|RS5_RUEPO | 30S ribosomal protein S5 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsE PE=3 SV=1 | 112 | 259 | 1.0E-10 |
| sp|Q3A6N0|RS5_PELCD | 30S ribosomal protein S5 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsE PE=3 SV=1 | 109 | 253 | 1.0E-10 |
| sp|Q98PZ9|RS5_MYCPU | 30S ribosomal protein S5 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsE PE=3 SV=1 | 144 | 254 | 1.0E-10 |
| sp|Q16AC7|RS5_ROSDO | 30S ribosomal protein S5 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsE PE=3 SV=1 | 112 | 259 | 1.0E-10 |
| sp|A4XZ73|RS5_PSEMY | 30S ribosomal protein S5 OS=Pseudomonas mendocina (strain ymp) GN=rpsE PE=3 SV=1 | 116 | 259 | 1.0E-10 |
| sp|A5IYW9|RS5_MYCAP | 30S ribosomal protein S5 OS=Mycoplasma agalactiae (strain PG2) GN=rpsE PE=3 SV=1 | 144 | 264 | 1.0E-10 |
| sp|B8ELE6|RS5_METSB | 30S ribosomal protein S5 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsE PE=3 SV=1 | 144 | 253 | 1.0E-10 |
| sp|B6JEY2|RS5_OLICO | 30S ribosomal protein S5 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsE PE=3 SV=1 | 144 | 259 | 1.0E-10 |
| sp|B5ELZ6|RS5_ACIF5 | 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsE PE=3 SV=1 | 144 | 250 | 1.0E-10 |
| sp|B7J484|RS5_ACIF2 | 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsE PE=3 SV=1 | 144 | 250 | 1.0E-10 |
| sp|Q0ABF8|RS5_ALKEH | 30S ribosomal protein S5 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsE PE=3 SV=1 | 141 | 253 | 1.0E-10 |
| sp|B8ISA2|RS5_METNO | 30S ribosomal protein S5 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsE PE=3 SV=1 | 144 | 254 | 1.0E-10 |
| sp|A6X0D5|RS5_OCHA4 | 30S ribosomal protein S5 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsE PE=3 SV=1 | 144 | 274 | 1.0E-10 |
| sp|Q0AUJ7|RS5_SYNWW | 30S ribosomal protein S5 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsE PE=3 SV=1 | 144 | 255 | 1.0E-10 |
| sp|P47414|RS5_MYCGE | 30S ribosomal protein S5 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsE PE=3 SV=1 | 123 | 250 | 2.0E-10 |
| sp|A5FZU8|RS5_ACICJ | 30S ribosomal protein S5 OS=Acidiphilium cryptum (strain JF-5) GN=rpsE PE=3 SV=1 | 144 | 259 | 2.0E-10 |
| sp|Q5PA75|RS5_ANAMM | 30S ribosomal protein S5 OS=Anaplasma marginale (strain St. Maries) GN=rpsE PE=3 SV=1 | 144 | 250 | 2.0E-10 |
| sp|B9KJ53|RS5_ANAMF | 30S ribosomal protein S5 OS=Anaplasma marginale (strain Florida) GN=rpsE PE=3 SV=1 | 144 | 250 | 2.0E-10 |
| sp|Q3YRM6|RS5_EHRCJ | 30S ribosomal protein S5 OS=Ehrlichia canis (strain Jake) GN=rpsE PE=3 SV=1 | 120 | 250 | 2.0E-10 |
| sp|Q2LQC0|RS5_SYNAS | 30S ribosomal protein S5 OS=Syntrophus aciditrophicus (strain SB) GN=rpsE PE=3 SV=1 | 115 | 253 | 2.0E-10 |
| sp|Q6G2Y2|RS5_BARHE | 30S ribosomal protein S5 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsE PE=3 SV=1 | 144 | 274 | 2.0E-10 |
| sp|A5WCK7|RS5_PSYWF | 30S ribosomal protein S5 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsE PE=3 SV=1 | 116 | 254 | 2.0E-10 |
| sp|B0UX31|RS5_HISS2 | 30S ribosomal protein S5 OS=Histophilus somni (strain 2336) GN=rpsE PE=3 SV=1 | 107 | 253 | 2.0E-10 |
| sp|Q0I145|RS5_HAES1 | 30S ribosomal protein S5 OS=Haemophilus somnus (strain 129Pt) GN=rpsE PE=3 SV=1 | 107 | 253 | 2.0E-10 |
| sp|Q6FZD9|RS5_BARQU | 30S ribosomal protein S5 OS=Bartonella quintana (strain Toulouse) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-10 |
| sp|B3E847|RS5_GEOLS | 30S ribosomal protein S5 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-10 |
| sp|Q7VQD1|RS5_BLOFL | 30S ribosomal protein S5 OS=Blochmannia floridanus GN=rpsE PE=3 SV=1 | 114 | 259 | 2.0E-10 |
| sp|A1TYL4|RS5_MARHV | 30S ribosomal protein S5 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsE PE=3 SV=1 | 111 | 259 | 2.0E-10 |
| sp|Q6LV99|RS5_PHOPR | 30S ribosomal protein S5 OS=Photobacterium profundum GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-10 |
| sp|Q2N9C8|RS5_ERYLH | 30S ribosomal protein S5 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsE PE=3 SV=1 | 116 | 254 | 2.0E-10 |
| sp|Q2RQX7|RS5_RHORT | 30S ribosomal protein S5 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsE PE=3 SV=1 | 144 | 259 | 3.0E-10 |
| sp|Q6ME47|RS5_PARUW | 30S ribosomal protein S5 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-10 |
| sp|B0UHV2|RS5_METS4 | 30S ribosomal protein S5 OS=Methylobacterium sp. (strain 4-46) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-10 |
| sp|P66571|RS5_BRUSU | 30S ribosomal protein S5 OS=Brucella suis biovar 1 (strain 1330) GN=rpsE PE=3 SV=1 | 144 | 274 | 3.0E-10 |
| sp|B0CH15|RS5_BRUSI | 30S ribosomal protein S5 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsE PE=3 SV=1 | 144 | 274 | 3.0E-10 |
| sp|P66570|RS5_BRUME | 30S ribosomal protein S5 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsE PE=3 SV=1 | 144 | 274 | 3.0E-10 |
| sp|C0RJI4|RS5_BRUMB | 30S ribosomal protein S5 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsE PE=3 SV=1 | 144 | 274 | 3.0E-10 |
| sp|A9M5N3|RS5_BRUC2 | 30S ribosomal protein S5 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsE PE=3 SV=1 | 144 | 274 | 3.0E-10 |
| sp|Q57CS5|RS5_BRUAB | 30S ribosomal protein S5 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsE PE=3 SV=1 | 144 | 274 | 3.0E-10 |
| sp|Q2YRT3|RS5_BRUA2 | 30S ribosomal protein S5 OS=Brucella abortus (strain 2308) GN=rpsE PE=3 SV=1 | 144 | 274 | 3.0E-10 |
| sp|B2S662|RS5_BRUA1 | 30S ribosomal protein S5 OS=Brucella abortus (strain S19) GN=rpsE PE=3 SV=1 | 144 | 274 | 3.0E-10 |
| sp|Q65QX2|RS5_MANSM | 30S ribosomal protein S5 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsE PE=3 SV=1 | 125 | 253 | 3.0E-10 |
| sp|Q0VSI6|RS5_ALCBS | 30S ribosomal protein S5 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsE PE=3 SV=1 | 111 | 259 | 3.0E-10 |
| sp|A8IAP6|RS5_AZOC5 | 30S ribosomal protein S5 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsE PE=3 SV=1 | 144 | 286 | 3.0E-10 |
| sp|A5VQY9|RS5_BRUO2 | 30S ribosomal protein S5 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsE PE=3 SV=1 | 144 | 274 | 4.0E-10 |
| sp|A5CXM1|RS5_VESOH | 30S ribosomal protein S5 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpsE PE=3 SV=1 | 127 | 259 | 4.0E-10 |
| sp|Q5FU00|RS5_GLUOX | 30S ribosomal protein S5 OS=Gluconobacter oxydans (strain 621H) GN=rpsE PE=3 SV=1 | 144 | 259 | 4.0E-10 |
| sp|Q605C9|RS5_METCA | 30S ribosomal protein S5 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsE PE=3 SV=1 | 107 | 255 | 4.0E-10 |
| sp|Q9HWF2|RS5_PSEAE | 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsE PE=3 SV=1 | 116 | 259 | 4.0E-10 |
| sp|Q02T63|RS5_PSEAB | 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsE PE=3 SV=1 | 116 | 259 | 4.0E-10 |
| sp|B7V661|RS5_PSEA8 | 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsE PE=3 SV=1 | 116 | 259 | 4.0E-10 |
| sp|A6UZK5|RS5_PSEA7 | 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsE PE=3 SV=1 | 116 | 259 | 4.0E-10 |
| sp|Q9CL47|RS5_PASMU | 30S ribosomal protein S5 OS=Pasteurella multocida (strain Pm70) GN=rpsE PE=3 SV=1 | 107 | 253 | 4.0E-10 |
| sp|Q9Z7S3|RS5_CHLPN | 30S ribosomal protein S5 OS=Chlamydia pneumoniae GN=rpsE PE=3 SV=1 | 144 | 253 | 4.0E-10 |
| sp|Q5HAT9|RS5_EHRRW | 30S ribosomal protein S5 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpsE PE=3 SV=1 | 120 | 250 | 4.0E-10 |
| sp|Q5FFR5|RS5_EHRRG | 30S ribosomal protein S5 OS=Ehrlichia ruminantium (strain Gardel) GN=rpsE PE=3 SV=2 | 120 | 250 | 4.0E-10 |
| sp|Q8D1Z5|RS5_WIGBR | 30S ribosomal protein S5 OS=Wigglesworthia glossinidia brevipalpis GN=rpsE PE=3 SV=1 | 117 | 264 | 5.0E-10 |
| sp|A7ZFZ5|RS5_CAMC1 | 30S ribosomal protein S5 OS=Campylobacter concisus (strain 13826) GN=rpsE PE=3 SV=1 | 129 | 253 | 5.0E-10 |
| sp|Q98N40|RS5_RHILO | 30S ribosomal protein S5 OS=Rhizobium loti (strain MAFF303099) GN=rpsE PE=3 SV=2 | 144 | 274 | 5.0E-10 |
| sp|Q4A5D8|RS5_MYCS5 | 30S ribosomal protein S5 OS=Mycoplasma synoviae (strain 53) GN=rpsE PE=3 SV=2 | 144 | 253 | 5.0E-10 |
| sp|A0KF38|RS5_AERHH | 30S ribosomal protein S5 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsE PE=3 SV=1 | 125 | 259 | 6.0E-10 |
| sp|A3N374|RS5_ACTP2 | 30S ribosomal protein S5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsE PE=3 SV=1 | 125 | 253 | 6.0E-10 |
| sp|B4R8N4|RS5_PHEZH | 30S ribosomal protein S5 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsE PE=3 SV=1 | 144 | 280 | 6.0E-10 |
| sp|Q11HR9|RS5_CHESB | 30S ribosomal protein S5 OS=Chelativorans sp. (strain BNC1) GN=rpsE PE=3 SV=1 | 144 | 274 | 6.0E-10 |
| sp|A8LM74|RS5_DINSH | 30S ribosomal protein S5 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsE PE=3 SV=1 | 112 | 259 | 6.0E-10 |
| sp|Q2GH39|RS5_EHRCR | 30S ribosomal protein S5 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpsE PE=3 SV=1 | 120 | 250 | 7.0E-10 |
| sp|A7HZM3|RS5_CAMHC | 30S ribosomal protein S5 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpsE PE=3 SV=1 | 129 | 253 | 7.0E-10 |
| sp|P44374|RS5_HAEIN | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsE PE=3 SV=1 | 115 | 253 | 8.0E-10 |
| sp|A5UHU8|RS5_HAEIG | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittGG) GN=rpsE PE=3 SV=1 | 115 | 253 | 8.0E-10 |
| sp|A5UDT0|RS5_HAEIE | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittEE) GN=rpsE PE=3 SV=1 | 115 | 253 | 8.0E-10 |
| sp|Q4QMA4|RS5_HAEI8 | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsE PE=3 SV=1 | 115 | 253 | 8.0E-10 |
| sp|P27152|RS5_THETH | 30S ribosomal protein S5 OS=Thermus thermophilus GN=rpsE PE=1 SV=4 | 123 | 254 | 8.0E-10 |
| sp|Q5SHQ5|RS5_THET8 | 30S ribosomal protein S5 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsE PE=1 SV=3 | 123 | 254 | 8.0E-10 |
| sp|P62665|RS5_THET2 | 30S ribosomal protein S5 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsE PE=1 SV=2 | 123 | 254 | 8.0E-10 |
| sp|A6TEV5|RS5_KLEP7 | 30S ribosomal protein S5 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsE PE=3 SV=1 | 125 | 254 | 9.0E-10 |
| sp|A4SSY9|RS5_AERS4 | 30S ribosomal protein S5 OS=Aeromonas salmonicida (strain A449) GN=rpsE PE=3 SV=1 | 125 | 260 | 1.0E-09 |
| sp|Q30Z59|RS5_DESAG | 30S ribosomal protein S5 OS=Desulfovibrio alaskensis (strain G20) GN=rpsE PE=3 SV=1 | 144 | 248 | 1.0E-09 |
| sp|Q3ZZQ7|RS5_DEHMC | 30S ribosomal protein S5 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsE PE=3 SV=1 | 111 | 259 | 1.0E-09 |
| sp|Q32B48|RS5_SHIDS | 30S ribosomal protein S5 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsE PE=3 SV=1 | 125 | 259 | 1.0E-09 |
| sp|Q0ANR7|RS5_MARMM | 30S ribosomal protein S5 OS=Maricaulis maris (strain MCS10) GN=rpsE PE=3 SV=1 | 142 | 259 | 1.0E-09 |
| sp|A4WFB1|RS5_ENT38 | 30S ribosomal protein S5 OS=Enterobacter sp. (strain 638) GN=rpsE PE=3 SV=1 | 125 | 259 | 1.0E-09 |
| sp|Q28UT7|RS5_JANSC | 30S ribosomal protein S5 OS=Jannaschia sp. (strain CCS1) GN=rpsE PE=3 SV=1 | 112 | 259 | 1.0E-09 |
| sp|Q87SZ6|RS5_VIBPA | 30S ribosomal protein S5 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsE PE=3 SV=1 | 125 | 253 | 2.0E-09 |
| sp|A7MWH5|RS5_VIBCB | 30S ribosomal protein S5 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsE PE=3 SV=1 | 125 | 253 | 2.0E-09 |
| sp|B5FG26|RS5_VIBFM | 30S ribosomal protein S5 OS=Vibrio fischeri (strain MJ11) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|Q5E897|RS5_VIBF1 | 30S ribosomal protein S5 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|B7VLE0|RS5_VIBTL | 30S ribosomal protein S5 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsE PE=3 SV=1 | 125 | 253 | 2.0E-09 |
| sp|Q7VKF0|RS5_HAEDU | 30S ribosomal protein S5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsE PE=3 SV=1 | 125 | 253 | 2.0E-09 |
| sp|Q3Z964|RS5_DEHM1 | 30S ribosomal protein S5 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsE PE=3 SV=1 | 111 | 259 | 2.0E-09 |
| sp|B6EPU2|RS5_ALISL | 30S ribosomal protein S5 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|A1W325|RS5_ACISJ | 30S ribosomal protein S5 OS=Acidovorax sp. (strain JS42) GN=rpsE PE=3 SV=1 | 112 | 253 | 2.0E-09 |
| sp|B9MBV4|RS5_ACIET | 30S ribosomal protein S5 OS=Acidovorax ebreus (strain TPSY) GN=rpsE PE=3 SV=1 | 112 | 253 | 2.0E-09 |
| sp|A7MPG7|RS5_CROS8 | 30S ribosomal protein S5 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsE PE=3 SV=1 | 125 | 250 | 2.0E-09 |
| sp|Q3YWV6|RS5_SHISS | 30S ribosomal protein S5 OS=Shigella sonnei (strain Ss046) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|P0A7W6|RS5_SHIFL | 30S ribosomal protein S5 OS=Shigella flexneri GN=rpsE PE=3 SV=2 | 125 | 259 | 2.0E-09 |
| sp|Q0SZZ9|RS5_SHIF8 | 30S ribosomal protein S5 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|Q31VX3|RS5_SHIBS | 30S ribosomal protein S5 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|P0A7W4|RS5_SALTY | 30S ribosomal protein S5 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsE PE=1 SV=2 | 125 | 259 | 2.0E-09 |
| sp|P0A7W5|RS5_SALTI | 30S ribosomal protein S5 OS=Salmonella typhi GN=rpsE PE=3 SV=2 | 125 | 259 | 2.0E-09 |
| sp|A9MSY1|RS5_SALPB | 30S ribosomal protein S5 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|Q5PK01|RS5_SALPA | 30S ribosomal protein S5 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|Q57J49|RS5_SALCH | 30S ribosomal protein S5 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|A9MN66|RS5_SALAR | 30S ribosomal protein S5 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|Q1R627|RS5_ECOUT | 30S ribosomal protein S5 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|P0A7W1|RS5_ECOLI | 30S ribosomal protein S5 OS=Escherichia coli (strain K12) GN=rpsE PE=1 SV=2 | 125 | 259 | 2.0E-09 |
| sp|B1IPZ6|RS5_ECOLC | 30S ribosomal protein S5 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|P0A7W2|RS5_ECOL6 | 30S ribosomal protein S5 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsE PE=3 SV=2 | 125 | 259 | 2.0E-09 |
| sp|Q0TCF8|RS5_ECOL5 | 30S ribosomal protein S5 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|A1AGJ2|RS5_ECOK1 | 30S ribosomal protein S5 OS=Escherichia coli O1:K1 / APEC GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|A8A5A8|RS5_ECOHS | 30S ribosomal protein S5 OS=Escherichia coli O9:H4 (strain HS) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|P0A7W3|RS5_ECO57 | 30S ribosomal protein S5 OS=Escherichia coli O157:H7 GN=rpsE PE=3 SV=2 | 125 | 259 | 2.0E-09 |
| sp|A7ZSJ2|RS5_ECO24 | 30S ribosomal protein S5 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|A8AQJ8|RS5_CITK8 | 30S ribosomal protein S5 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsE PE=3 SV=1 | 125 | 259 | 2.0E-09 |
| sp|A1S235|RS5_SHEAM | 30S ribosomal protein S5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsE PE=3 SV=1 | 119 | 253 | 2.0E-09 |
| sp|Q4FLN5|RS5_PELUB | 30S ribosomal protein S5 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsE PE=3 SV=1 | 144 | 259 | 2.0E-09 |
| sp|Q2NQN9|RS5_SODGM | 30S ribosomal protein S5 OS=Sodalis glossinidius (strain morsitans) GN=rpsE PE=3 SV=1 | 125 | 253 | 3.0E-09 |
| sp|Q6CZY7|RS5_PECAS | 30S ribosomal protein S5 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsE PE=3 SV=1 | 125 | 250 | 3.0E-09 |
| sp|Q7MPH1|RS5_VIBVY | 30S ribosomal protein S5 OS=Vibrio vulnificus (strain YJ016) GN=rpsE PE=3 SV=1 | 125 | 253 | 4.0E-09 |
| sp|Q8DE57|RS5_VIBVU | 30S ribosomal protein S5 OS=Vibrio vulnificus (strain CMCP6) GN=rpsE PE=3 SV=1 | 125 | 253 | 4.0E-09 |
| sp|A6VLK5|RS5_ACTSZ | 30S ribosomal protein S5 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsE PE=3 SV=1 | 125 | 253 | 4.0E-09 |
| sp|Q5NQ48|RS5_ZYMMO | 30S ribosomal protein S5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsE PE=3 SV=1 | 116 | 259 | 4.0E-09 |
| sp|A0M581|RS5_GRAFK | 30S ribosomal protein S5 OS=Gramella forsetii (strain KT0803) GN=rpsE PE=3 SV=1 | 144 | 253 | 4.0E-09 |
| sp|A1RED1|RS5_SHESW | 30S ribosomal protein S5 OS=Shewanella sp. (strain W3-18-1) GN=rpsE PE=3 SV=1 | 111 | 253 | 4.0E-09 |
| sp|A4YBW6|RS5_SHEPC | 30S ribosomal protein S5 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsE PE=3 SV=1 | 111 | 253 | 4.0E-09 |
| sp|B5ZYV2|RS5_RHILW | 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-09 |
| sp|Q2K9J9|RS5_RHIEC | 30S ribosomal protein S5 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-09 |
| sp|B3PWT8|RS5_RHIE6 | 30S ribosomal protein S5 OS=Rhizobium etli (strain CIAT 652) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-09 |
| sp|Q7VGC7|RS5_HELHP | 30S ribosomal protein S5 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsE PE=3 SV=1 | 129 | 253 | 4.0E-09 |
| sp|Q1MIC4|RS5_RHIL3 | 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-09 |
| sp|Q89A82|RS5_BUCBP | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsE PE=3 SV=2 | 117 | 259 | 4.0E-09 |
| sp|Q057C1|RS5_BUCCC | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsE PE=3 SV=1 | 119 | 259 | 5.0E-09 |
| sp|A1WK99|RS5_VEREI | 30S ribosomal protein S5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsE PE=3 SV=1 | 119 | 253 | 5.0E-09 |
| sp|Q8K966|RS5_BUCAP | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsE PE=3 SV=1 | 125 | 259 | 5.0E-09 |
| sp|A1JS11|RS5_YERE8 | 30S ribosomal protein S5 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsE PE=3 SV=1 | 125 | 254 | 5.0E-09 |
| sp|A9BRW8|RS5_DELAS | 30S ribosomal protein S5 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsE PE=3 SV=1 | 119 | 260 | 5.0E-09 |
| sp|A1RWR6|RS5_THEPD | 30S ribosomal protein S5 OS=Thermofilum pendens (strain Hrk 5) GN=rps5 PE=3 SV=1 | 119 | 254 | 6.0E-09 |
| sp|A8ESW0|RS5_ARCB4 | 30S ribosomal protein S5 OS=Arcobacter butzleri (strain RM4018) GN=rpsE PE=3 SV=1 | 144 | 253 | 6.0E-09 |
| sp|Q0BYD1|RS5_HYPNA | 30S ribosomal protein S5 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsE PE=3 SV=1 | 144 | 259 | 6.0E-09 |
| sp|Q3IJK2|RS5_PSEHT | 30S ribosomal protein S5 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsE PE=3 SV=1 | 113 | 259 | 6.0E-09 |
| sp|P0DE95|RS5_STRPQ | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|Q48VT2|RS5_STRPM | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|A2RC31|RS5_STRPG | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|Q1J8Z6|RS5_STRPF | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|Q1JJ45|RS5_STRPD | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|Q1JP00|RS5_STRPC | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|Q1JE42|RS5_STRPB | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|P66585|RS5_STRP8 | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|Q5XEB8|RS5_STRP6 | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|P0DE94|RS5_STRP3 | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|P66583|RS5_STRP1 | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M1 GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-09 |
| sp|A6GZ82|RS5_FLAPJ | 30S ribosomal protein S5 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsE PE=3 SV=1 | 144 | 253 | 6.0E-09 |
| sp|Q0I088|RS5_SHESR | 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-7) GN=rpsE PE=3 SV=1 | 111 | 253 | 6.0E-09 |
| sp|Q0HNS0|RS5_SHESM | 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-4) GN=rpsE PE=3 SV=1 | 111 | 253 | 6.0E-09 |
| sp|A0KRP1|RS5_SHESA | 30S ribosomal protein S5 OS=Shewanella sp. (strain ANA-3) GN=rpsE PE=3 SV=1 | 111 | 253 | 6.0E-09 |
| sp|P59124|RS5_SHEON | 30S ribosomal protein S5 OS=Shewanella oneidensis (strain MR-1) GN=rpsE PE=3 SV=1 | 111 | 253 | 6.0E-09 |
| sp|A0T0Y9|RR5_THAPS | 30S ribosomal protein S5, chloroplastic OS=Thalassiosira pseudonana GN=rps5 PE=3 SV=1 | 114 | 255 | 6.0E-09 |
| sp|A0T0J5|RR5_PHATC | 30S ribosomal protein S5, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps5 PE=3 SV=1 | 123 | 254 | 8.0E-09 |
| sp|A1T0C5|RS5_PSYIN | 30S ribosomal protein S5 OS=Psychromonas ingrahamii (strain 37) GN=rpsE PE=3 SV=1 | 114 | 259 | 8.0E-09 |
| sp|B4SBW4|RS5_PELPB | 30S ribosomal protein S5 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpsE PE=3 SV=1 | 104 | 255 | 8.0E-09 |
| sp|P49493|RR5_ODOSI | 30S ribosomal protein S5, chloroplastic OS=Odontella sinensis GN=rps5 PE=3 SV=1 | 114 | 248 | 9.0E-09 |
| sp|Q5GSW1|RS5_WOLTR | 30S ribosomal protein S5 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsE PE=3 SV=1 | 120 | 280 | 9.0E-09 |
| sp|B9JVQ4|RS5_AGRVS | 30S ribosomal protein S5 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsE PE=3 SV=1 | 144 | 254 | 1.0E-08 |
| sp|Q664T8|RS5_YERPS | 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsE PE=3 SV=1 | 125 | 254 | 1.0E-08 |
| sp|A4TH09|RS5_YERPP | 30S ribosomal protein S5 OS=Yersinia pestis (strain Pestoides F) GN=rpsE PE=3 SV=1 | 125 | 254 | 1.0E-08 |
| sp|Q1CCW1|RS5_YERPN | 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsE PE=3 SV=1 | 125 | 254 | 1.0E-08 |
| sp|Q8ZJ95|RS5_YERPE | 30S ribosomal protein S5 OS=Yersinia pestis GN=rpsE PE=3 SV=1 | 125 | 254 | 1.0E-08 |
| sp|Q1C2W4|RS5_YERPA | 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsE PE=3 SV=1 | 125 | 254 | 1.0E-08 |
| sp|A7FNL7|RS5_YERP3 | 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsE PE=3 SV=1 | 125 | 254 | 1.0E-08 |
| sp|B4RT45|RS5_ALTMD | 30S ribosomal protein S5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsE PE=3 SV=1 | 116 | 260 | 1.0E-08 |
| sp|Q089N7|RS5_SHEFN | 30S ribosomal protein S5 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsE PE=3 SV=1 | 111 | 253 | 1.0E-08 |
| sp|Q12SU2|RS5_SHEDO | 30S ribosomal protein S5 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsE PE=3 SV=1 | 111 | 253 | 1.0E-08 |
| sp|O52349|RS5_MYCGA | 30S ribosomal protein S5 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpsE PE=3 SV=2 | 123 | 259 | 1.0E-08 |
| sp|Q8UE35|RS5_AGRFC | 30S ribosomal protein S5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsE PE=3 SV=1 | 144 | 254 | 1.0E-08 |
| sp|A8GKI0|RS5_SERP5 | 30S ribosomal protein S5 OS=Serratia proteamaculans (strain 568) GN=rpsE PE=3 SV=1 | 125 | 254 | 1.0E-08 |
| sp|Q73HA3|RS5_WOLPM | 30S ribosomal protein S5 OS=Wolbachia pipientis wMel GN=rpsE PE=3 SV=1 | 121 | 280 | 1.0E-08 |
| sp|Q30TU7|RS5_SULDN | 30S ribosomal protein S5 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsE PE=3 SV=1 | 144 | 253 | 1.0E-08 |
| sp|C4L7U7|RS5_TOLAT | 30S ribosomal protein S5 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsE PE=3 SV=1 | 113 | 253 | 1.0E-08 |
| sp|Q74MD4|RS5_NANEQ | 30S ribosomal protein S5 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps5 PE=3 SV=1 | 127 | 254 | 1.0E-08 |
| sp|Q0SN12|RS5_BORAP | 30S ribosomal protein S5 OS=Borrelia afzelii (strain PKo) GN=rpsE PE=3 SV=1 | 117 | 251 | 1.0E-08 |
| sp|A5USH2|RS5_ROSS1 | 30S ribosomal protein S5 OS=Roseiflexus sp. (strain RS-1) GN=rpsE PE=3 SV=1 | 144 | 255 | 1.0E-08 |
| sp|Q7M8E9|RS5_WOLSU | 30S ribosomal protein S5 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsE PE=3 SV=1 | 129 | 253 | 1.0E-08 |
| sp|A2SLE0|RS5_METPP | 30S ribosomal protein S5 OS=Methylibium petroleiphilum (strain PM1) GN=rpsE PE=3 SV=1 | 144 | 260 | 2.0E-08 |
| sp|A1BJ17|RS5_CHLPD | 30S ribosomal protein S5 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsE PE=3 SV=1 | 111 | 255 | 2.0E-08 |
| sp|Q12G86|RS5_POLSJ | 30S ribosomal protein S5 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsE PE=3 SV=1 | 119 | 254 | 2.0E-08 |
| sp|A6LEH4|RS5_PARD8 | 30S ribosomal protein S5 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsE PE=3 SV=1 | 129 | 253 | 2.0E-08 |
| sp|Q47J86|RS5_DECAR | 30S ribosomal protein S5 OS=Dechloromonas aromatica (strain RCB) GN=rpsE PE=3 SV=1 | 136 | 250 | 2.0E-08 |
| sp|Q6AP53|RS5_DESPS | 30S ribosomal protein S5 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-08 |
| sp|P57574|RS5_BUCAI | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsE PE=3 SV=1 | 125 | 253 | 2.0E-08 |
| sp|B5ZB57|RS5_UREU1 | 30S ribosomal protein S5 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsE PE=3 SV=1 | 129 | 253 | 2.0E-08 |
| sp|C3LRP1|RS5_VIBCM | 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsE PE=3 SV=1 | 125 | 253 | 2.0E-08 |
| sp|Q9KP01|RS5_VIBCH | 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsE PE=3 SV=1 | 125 | 253 | 2.0E-08 |
| sp|A5F563|RS5_VIBC3 | 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsE PE=3 SV=1 | 125 | 253 | 2.0E-08 |
| sp|Q824N5|RS5_CHLCV | 30S ribosomal protein S5 OS=Chlamydophila caviae (strain GPIC) GN=rpsE PE=3 SV=1 | 144 | 253 | 2.0E-08 |
| sp|Q50301|RS5_MYCPN | 30S ribosomal protein S5 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpsE PE=3 SV=1 | 123 | 250 | 2.0E-08 |
| sp|A4WVJ1|RS5_RHOS5 | 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsE PE=3 SV=1 | 144 | 259 | 3.0E-08 |
| sp|B3QR82|RS5_CHLP8 | 30S ribosomal protein S5 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpsE PE=3 SV=1 | 106 | 255 | 3.0E-08 |
| sp|B9KLA8|RS5_RHOSK | 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsE PE=3 SV=1 | 144 | 259 | 3.0E-08 |
| sp|Q3J5Q5|RS5_RHOS4 | 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsE PE=3 SV=1 | 144 | 259 | 3.0E-08 |
| sp|A3PGM8|RS5_RHOS1 | 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsE PE=3 SV=1 | 144 | 259 | 3.0E-08 |
| sp|Q3APJ0|RS5_CHLCH | 30S ribosomal protein S5 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpsE PE=3 SV=1 | 111 | 254 | 3.0E-08 |
| sp|Q3IMW8|RS5_NATPD | 30S ribosomal protein S5 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps5 PE=3 SV=1 | 119 | 254 | 3.0E-08 |
| sp|Q9Z9J7|RS5_BACHD | 30S ribosomal protein S5 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsE PE=3 SV=1 | 110 | 254 | 3.0E-08 |
| sp|Q8KAI8|RS5_CHLTE | 30S ribosomal protein S5 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpsE PE=3 SV=1 | 110 | 254 | 3.0E-08 |
| sp|A3Q999|RS5_SHELP | 30S ribosomal protein S5 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsE PE=3 SV=1 | 119 | 253 | 3.0E-08 |
| sp|O51448|RS5_BORBU | 30S ribosomal protein S5 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsE PE=3 SV=1 | 109 | 251 | 3.0E-08 |
| sp|A1B044|RS5_PARDP | 30S ribosomal protein S5 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsE PE=3 SV=1 | 112 | 259 | 3.0E-08 |
| sp|Q9PQP3|RS5_UREPA | 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsE PE=3 SV=1 | 129 | 253 | 3.0E-08 |
| sp|B1AIN7|RS5_UREP2 | 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsE PE=3 SV=1 | 129 | 253 | 3.0E-08 |
| sp|A1VJ32|RS5_POLNA | 30S ribosomal protein S5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsE PE=3 SV=1 | 123 | 254 | 3.0E-08 |
| sp|Q3J8T1|RS5_NITOC | 30S ribosomal protein S5 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsE PE=3 SV=1 | 141 | 253 | 3.0E-08 |
| sp|Q82X75|RS5_NITEU | 30S ribosomal protein S5 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsE PE=3 SV=1 | 102 | 259 | 3.0E-08 |
| sp|Q1MPP8|RS5_LAWIP | 30S ribosomal protein S5 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsE PE=3 SV=1 | 111 | 255 | 4.0E-08 |
| sp|B3EGX3|RS5_CHLL2 | 30S ribosomal protein S5 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsE PE=3 SV=1 | 110 | 255 | 4.0E-08 |
| sp|A0LIK7|RS5_SYNFM | 30S ribosomal protein S5 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsE PE=3 SV=1 | 109 | 254 | 4.0E-08 |
| sp|B3EP44|RS5_CHLPB | 30S ribosomal protein S5 OS=Chlorobium phaeobacteroides (strain BS1) GN=rpsE PE=3 SV=1 | 104 | 255 | 4.0E-08 |
| sp|Q5L704|RS5_CHLAB | 30S ribosomal protein S5 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsE PE=3 SV=1 | 144 | 253 | 4.0E-08 |
| sp|B4S5B1|RS5_PROA2 | 30S ribosomal protein S5 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpsE PE=3 SV=1 | 104 | 255 | 4.0E-08 |
| sp|A8AC00|RS5_IGNH4 | 30S ribosomal protein S5 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps5 PE=3 SV=1 | 119 | 254 | 4.0E-08 |
| sp|Q661C5|RS5_BORBP | 30S ribosomal protein S5 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsE PE=3 SV=1 | 117 | 251 | 4.0E-08 |
| sp|Q839E7|RS5_ENTFA | 30S ribosomal protein S5 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsE PE=3 SV=1 | 109 | 254 | 5.0E-08 |
| sp|A3CT17|RS5_METMJ | 30S ribosomal protein S5 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps5 PE=3 SV=1 | 119 | 254 | 5.0E-08 |
| sp|Q2FSG3|RS5_METHJ | 30S ribosomal protein S5 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps5 PE=3 SV=1 | 118 | 255 | 5.0E-08 |
| sp|A4SCS6|RS5_CHLPM | 30S ribosomal protein S5 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpsE PE=3 SV=1 | 111 | 255 | 5.0E-08 |
| sp|C3MAZ7|RS5_RHISN | 30S ribosomal protein S5 OS=Rhizobium sp. (strain NGR234) GN=rpsE PE=3 SV=1 | 144 | 254 | 5.0E-08 |
| sp|Q6AD11|RS5_LEIXX | 30S ribosomal protein S5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpsE PE=3 SV=1 | 144 | 259 | 6.0E-08 |
| sp|Q21QP0|RS5_RHOFT | 30S ribosomal protein S5 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsE PE=3 SV=1 | 136 | 260 | 6.0E-08 |
| sp|Q7UN03|RS5_RHOBA | 30S ribosomal protein S5 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsE PE=3 SV=1 | 144 | 250 | 6.0E-08 |
| sp|A8GT52|RS5_RICRS | 30S ribosomal protein S5 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsE PE=3 SV=1 | 145 | 254 | 6.0E-08 |
| sp|B0BUP3|RS5_RICRO | 30S ribosomal protein S5 OS=Rickettsia rickettsii (strain Iowa) GN=rpsE PE=3 SV=1 | 145 | 254 | 6.0E-08 |
| sp|Q12ZT1|RS5_METBU | 30S ribosomal protein S5 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps5 PE=3 SV=1 | 118 | 253 | 6.0E-08 |
| sp|Q5QXW2|RS5_IDILO | 30S ribosomal protein S5 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsE PE=3 SV=1 | 114 | 259 | 6.0E-08 |
| sp|A5CCJ5|RS5_ORITB | 30S ribosomal protein S5 OS=Orientia tsutsugamushi (strain Boryong) GN=rpsE PE=3 SV=1 | 140 | 259 | 7.0E-08 |
| sp|Q83EQ9|RS5_COXBU | 30S ribosomal protein S5 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsE PE=3 SV=1 | 144 | 259 | 7.0E-08 |
| sp|A4VSH0|RS5_STRSY | 30S ribosomal protein S5 OS=Streptococcus suis (strain 05ZYH33) GN=rpsE PE=3 SV=1 | 129 | 254 | 8.0E-08 |
| sp|A4VYQ9|RS5_STRS2 | 30S ribosomal protein S5 OS=Streptococcus suis (strain 98HAH33) GN=rpsE PE=3 SV=1 | 129 | 254 | 8.0E-08 |
| sp|O67563|RS5_AQUAE | 30S ribosomal protein S5 OS=Aquifex aeolicus (strain VF5) GN=rpsE PE=3 SV=1 | 144 | 253 | 8.0E-08 |
| sp|Q15X56|RS5_PSEA6 | 30S ribosomal protein S5 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsE PE=3 SV=1 | 119 | 253 | 9.0E-08 |
| sp|A8Z683|RS5_SULMW | 30S ribosomal protein S5 OS=Sulcia muelleri (strain GWSS) GN=rpsE PE=3 SV=1 | 144 | 253 | 9.0E-08 |
| sp|Q92GY3|RS5_RICCN | 30S ribosomal protein S5 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsE PE=3 SV=1 | 145 | 254 | 1.0E-07 |
| sp|C3PP90|RS5_RICAE | 30S ribosomal protein S5 OS=Rickettsia africae (strain ESF-5) GN=rpsE PE=3 SV=1 | 145 | 254 | 1.0E-07 |
| sp|Q5HSA7|RS5_CAMJR | 30S ribosomal protein S5 OS=Campylobacter jejuni (strain RM1221) GN=rpsE PE=3 SV=1 | 144 | 253 | 1.0E-07 |
| sp|A1W1U3|RS5_CAMJJ | 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsE PE=3 SV=1 | 144 | 253 | 1.0E-07 |
| sp|Q9PLY8|RS5_CAMJE | 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsE PE=3 SV=1 | 144 | 253 | 1.0E-07 |
| sp|A7H639|RS5_CAMJD | 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsE PE=3 SV=1 | 144 | 253 | 1.0E-07 |
| sp|A8FP04|RS5_CAMJ8 | 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsE PE=3 SV=1 | 144 | 253 | 1.0E-07 |
| sp|A7HBN5|RS5_ANADF | 30S ribosomal protein S5 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsE PE=3 SV=1 | 144 | 254 | 1.0E-07 |
| sp|A8F2D0|RS5_RICM5 | 30S ribosomal protein S5 OS=Rickettsia massiliae (strain Mtu5) GN=rpsE PE=3 SV=2 | 145 | 254 | 1.0E-07 |
| sp|Q055C7|RS5_LEPBL | 30S ribosomal protein S5 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpsE1 PE=3 SV=1 | 144 | 259 | 1.0E-07 |
| sp|Q04PV5|RS5_LEPBJ | 30S ribosomal protein S5 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpsE PE=3 SV=1 | 144 | 259 | 1.0E-07 |
| sp|A8GPD3|RS5_RICAH | 30S ribosomal protein S5 OS=Rickettsia akari (strain Hartford) GN=rpsE PE=3 SV=1 | 145 | 254 | 1.0E-07 |
| sp|C4K2G2|RS5_RICPU | 30S ribosomal protein S5 OS=Rickettsia peacockii (strain Rustic) GN=rpsE PE=3 SV=1 | 145 | 254 | 1.0E-07 |
| sp|Q4UMR2|RS5_RICFE | 30S ribosomal protein S5 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsE PE=3 SV=1 | 145 | 254 | 1.0E-07 |
| sp|Q3B6E5|RS5_CHLL7 | 30S ribosomal protein S5 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpsE PE=3 SV=1 | 111 | 255 | 1.0E-07 |
| sp|Q9ZCS2|RS5_RICPR | 30S ribosomal protein S5 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsE PE=3 SV=1 | 145 | 254 | 1.0E-07 |
| sp|Q68W95|RS5_RICTY | 30S ribosomal protein S5 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsE PE=3 SV=1 | 145 | 254 | 2.0E-07 |
| sp|A8EZJ9|RS5_RICCK | 30S ribosomal protein S5 OS=Rickettsia canadensis (strain McKiel) GN=rpsE PE=3 SV=1 | 140 | 254 | 2.0E-07 |
| sp|A6KYH8|RS5_BACV8 | 30S ribosomal protein S5 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsE PE=3 SV=1 | 129 | 253 | 2.0E-07 |
| sp|A6U876|RS5_SINMW | 30S ribosomal protein S5 OS=Sinorhizobium medicae (strain WSM419) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-07 |
| sp|Q92QF3|RS5_RHIME | 30S ribosomal protein S5 OS=Rhizobium meliloti (strain 1021) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-07 |
| sp|A9KWB9|RS5_SHEB9 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS195) GN=rpsE PE=3 SV=1 | 111 | 253 | 2.0E-07 |
| sp|A6WHU5|RS5_SHEB8 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS185) GN=rpsE PE=3 SV=1 | 111 | 253 | 2.0E-07 |
| sp|A3DA55|RS5_SHEB5 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsE PE=3 SV=1 | 111 | 253 | 2.0E-07 |
| sp|B8EBI8|RS5_SHEB2 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS223) GN=rpsE PE=3 SV=1 | 111 | 253 | 2.0E-07 |
| sp|Q9XD19|RS5_LEPIN | 30S ribosomal protein S5 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpsE PE=3 SV=3 | 144 | 259 | 2.0E-07 |
| sp|Q72NH8|RS5_LEPIC | 30S ribosomal protein S5 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpsE PE=3 SV=3 | 144 | 259 | 2.0E-07 |
| sp|A1VE99|RS5_DESVV | 30S ribosomal protein S5 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsE PE=3 SV=1 | 144 | 248 | 2.0E-07 |
| sp|Q72CG3|RS5_DESVH | 30S ribosomal protein S5 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsE PE=3 SV=1 | 144 | 248 | 2.0E-07 |
| sp|Q46WG1|RS5_CUPPJ | 30S ribosomal protein S5 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsE PE=3 SV=1 | 144 | 260 | 2.0E-07 |
| sp|A5V5Y5|RS5_SPHWW | 30S ribosomal protein S5 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsE PE=3 SV=1 | 116 | 254 | 2.0E-07 |
| sp|P26815|RS5_HALMA | 30S ribosomal protein S5 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps5 PE=3 SV=1 | 103 | 254 | 3.0E-07 |
| sp|A5D5H1|RS5_PELTS | 30S ribosomal protein S5 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsE PE=3 SV=1 | 111 | 259 | 3.0E-07 |
| sp|B3R7F1|RS5_CUPTR | 30S ribosomal protein S5 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-07 |
| sp|Q0K636|RS5_CUPNH | 30S ribosomal protein S5 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-07 |
| sp|A4J128|RS5_DESRM | 30S ribosomal protein S5 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-07 |
| sp|Q8A493|RS5_BACTN | 30S ribosomal protein S5 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsE PE=3 SV=1 | 129 | 253 | 3.0E-07 |
| sp|Q8PV30|RS5_METMA | 30S ribosomal protein S5 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps5 PE=3 SV=1 | 118 | 254 | 3.0E-07 |
| sp|Q8TRS7|RS5_METAC | 30S ribosomal protein S5 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps5 PE=3 SV=1 | 118 | 254 | 3.0E-07 |
| sp|Q46GB5|RS5_METBF | 30S ribosomal protein S5 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps5 PE=3 SV=1 | 118 | 254 | 3.0E-07 |
| sp|Q7MTN0|RS5_PORGI | 30S ribosomal protein S5 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsE PE=3 SV=1 | 129 | 259 | 3.0E-07 |
| sp|A4XLR3|RS5_CALS8 | 30S ribosomal protein S5 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsE PE=3 SV=1 | 111 | 254 | 4.0E-07 |
| sp|Q0SQG1|RS5_CLOPS | 30S ribosomal protein S5 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsE PE=3 SV=1 | 109 | 253 | 4.0E-07 |
| sp|Q8XHU0|RS5_CLOPE | 30S ribosomal protein S5 OS=Clostridium perfringens (strain 13 / Type A) GN=rpsE PE=3 SV=1 | 109 | 253 | 4.0E-07 |
| sp|Q0TMR3|RS5_CLOP1 | 30S ribosomal protein S5 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsE PE=3 SV=1 | 109 | 253 | 4.0E-07 |
| sp|Q64NM5|RS5_BACFR | 30S ribosomal protein S5 OS=Bacteroides fragilis (strain YCH46) GN=rpsE PE=3 SV=1 | 129 | 253 | 4.0E-07 |
| sp|Q5L8C6|RS5_BACFN | 30S ribosomal protein S5 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsE PE=3 SV=1 | 129 | 253 | 4.0E-07 |
| sp|A4IJK5|RS5_GEOTN | 30S ribosomal protein S5 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsE PE=3 SV=1 | 111 | 254 | 4.0E-07 |
| sp|Q03ED3|RS5_PEDPA | 30S ribosomal protein S5 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsE PE=3 SV=1 | 111 | 255 | 5.0E-07 |
| sp|Q38US8|RS5_LACSS | 30S ribosomal protein S5 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsE PE=3 SV=1 | 110 | 250 | 5.0E-07 |
| sp|C6C1A2|RS5_DESAD | 30S ribosomal protein S5 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsE PE=3 SV=1 | 144 | 267 | 5.0E-07 |
| sp|Q88XW9|RS5_LACPL | 30S ribosomal protein S5 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsE PE=3 SV=1 | 111 | 255 | 5.0E-07 |
| sp|A6QCR5|RS5_SULNB | 30S ribosomal protein S5 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsE PE=3 SV=1 | 144 | 253 | 5.0E-07 |
| sp|P02357|RS5_GEOSE | 30S ribosomal protein S5 OS=Geobacillus stearothermophilus GN=rpsE PE=1 SV=1 | 111 | 254 | 5.0E-07 |
| sp|C5CQ83|RS5_VARPS | 30S ribosomal protein S5 OS=Variovorax paradoxus (strain S110) GN=rpsE PE=3 SV=1 | 129 | 254 | 5.0E-07 |
| sp|Q927M4|RS5_LISIN | 30S ribosomal protein S5 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsE PE=3 SV=1 | 144 | 248 | 5.0E-07 |
| sp|A3CK81|RS5_STRSV | 30S ribosomal protein S5 OS=Streptococcus sanguinis (strain SK36) GN=rpsE PE=3 SV=1 | 129 | 254 | 5.0E-07 |
| sp|Q5WLP5|RS5_BACSK | 30S ribosomal protein S5 OS=Bacillus clausii (strain KSM-K16) GN=rpsE PE=3 SV=1 | 111 | 248 | 6.0E-07 |
| sp|Q7NQG9|RS5_CHRVO | 30S ribosomal protein S5 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsE PE=3 SV=1 | 166 | 250 | 6.0E-07 |
| sp|Q39KF0|RS5_BURL3 | 30S ribosomal protein S5 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsE PE=3 SV=1 | 136 | 250 | 6.0E-07 |
| sp|B4E5D7|RS5_BURCJ | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsE PE=3 SV=1 | 136 | 250 | 6.0E-07 |
| sp|Q2IJ66|RS5_ANADE | 30S ribosomal protein S5 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsE PE=3 SV=1 | 144 | 254 | 6.0E-07 |
| sp|A4JAQ7|RS5_BURVG | 30S ribosomal protein S5 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsE PE=3 SV=1 | 136 | 260 | 6.0E-07 |
| sp|Q0BJ29|RS5_BURCM | 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsE PE=3 SV=1 | 136 | 260 | 6.0E-07 |
| sp|A0K3P2|RS5_BURCH | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsE PE=3 SV=1 | 136 | 260 | 6.0E-07 |
| sp|B1JU39|RS5_BURCC | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsE PE=3 SV=1 | 136 | 260 | 6.0E-07 |
| sp|Q1BRW5|RS5_BURCA | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsE PE=3 SV=1 | 136 | 260 | 6.0E-07 |
| sp|B1YRP6|RS5_BURA4 | 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsE PE=3 SV=1 | 136 | 260 | 6.0E-07 |
| sp|A8AZK8|RS5_STRGC | 30S ribosomal protein S5 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsE PE=3 SV=1 | 129 | 254 | 6.0E-07 |
| sp|P66582|RS5_STRR6 | 30S ribosomal protein S5 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsE PE=3 SV=1 | 118 | 254 | 6.0E-07 |
| sp|P66581|RS5_STRPN | 30S ribosomal protein S5 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsE PE=3 SV=1 | 118 | 254 | 6.0E-07 |
| sp|Q04ML9|RS5_STRP2 | 30S ribosomal protein S5 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsE PE=3 SV=1 | 118 | 254 | 6.0E-07 |
| sp|A2BMD9|RS5_HYPBU | 30S ribosomal protein S5 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps5 PE=3 SV=1 | 118 | 257 | 6.0E-07 |
| sp|Q5L3S2|RS5_GEOKA | 30S ribosomal protein S5 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsE PE=3 SV=1 | 111 | 254 | 6.0E-07 |
| sp|Q2GEC2|RS5_NEOSM | 30S ribosomal protein S5 OS=Neorickettsia sennetsu (strain Miyayama) GN=rpsE PE=3 SV=1 | 119 | 239 | 6.0E-07 |
| sp|A3MU88|RS5_PYRCJ | 30S ribosomal protein S5 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps5 PE=3 SV=1 | 119 | 254 | 7.0E-07 |
| sp|A1TJT4|RS5_ACIAC | 30S ribosomal protein S5 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsE PE=3 SV=1 | 136 | 253 | 7.0E-07 |
| sp|A0RM28|RS5_CAMFF | 30S ribosomal protein S5 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpsE PE=3 SV=1 | 144 | 253 | 7.0E-07 |
| sp|Q03PX4|RS5_LACBA | 30S ribosomal protein S5 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsE PE=3 SV=1 | 111 | 250 | 8.0E-07 |
| sp|P10128|RS5_MYCCT | 30S ribosomal protein S5 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsE PE=3 SV=2 | 123 | 253 | 8.0E-07 |
| sp|B9MKG4|RS5_CALBD | 30S ribosomal protein S5 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsE PE=3 SV=1 | 144 | 254 | 8.0E-07 |
| sp|P21467|RS5_BACSU | 30S ribosomal protein S5 OS=Bacillus subtilis (strain 168) GN=rpsE PE=1 SV=3 | 111 | 253 | 8.0E-07 |
| sp|Q1XDJ0|RR5_PYRYE | 30S ribosomal protein S5, chloroplastic OS=Pyropia yezoensis GN=rps5 PE=3 SV=1 | 142 | 253 | 9.0E-07 |
| sp|P51298|RR5_PORPU | 30S ribosomal protein S5, chloroplastic OS=Porphyra purpurea GN=rps5 PE=3 SV=1 | 142 | 253 | 9.0E-07 |
| sp|A4G9S1|RS5_HERAR | 30S ribosomal protein S5 OS=Herminiimonas arsenicoxydans GN=rpsE PE=3 SV=1 | 136 | 260 | 9.0E-07 |
| sp|A0LRN7|RS5_ACIC1 | 30S ribosomal protein S5 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpsE PE=3 SV=1 | 144 | 255 | 9.0E-07 |
| sp|Q9RSL1|RS5_DEIRA | 30S ribosomal protein S5 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsE PE=3 SV=1 | 123 | 250 | 1.0E-06 |
| sp|B8DNB3|RS5_DESVM | 30S ribosomal protein S5 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsE PE=3 SV=1 | 144 | 248 | 1.0E-06 |
| sp|A7I5Q9|RS5_METB6 | 30S ribosomal protein S5 OS=Methanoregula boonei (strain 6A8) GN=rps5 PE=3 SV=1 | 119 | 254 | 1.0E-06 |
| sp|A7Z0Q5|RS5_BACMF | 30S ribosomal protein S5 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsE PE=3 SV=1 | 111 | 253 | 1.0E-06 |
| sp|Q97EJ5|RS5_CLOAB | 30S ribosomal protein S5 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsE PE=3 SV=1 | 109 | 253 | 1.0E-06 |
| sp|Q18CH3|RS5_PEPD6 | 30S ribosomal protein S5 OS=Peptoclostridium difficile (strain 630) GN=rpsE PE=3 SV=1 | 118 | 255 | 1.0E-06 |
| sp|Q252W9|RS5_CHLFF | 30S ribosomal protein S5 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsE PE=3 SV=1 | 144 | 253 | 1.0E-06 |
| sp|A5VLI8|RS5_LACRD | 30S ribosomal protein S5 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsE PE=3 SV=1 | 107 | 254 | 1.0E-06 |
| sp|A1WVA5|RS5_HALHL | 30S ribosomal protein S5 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsE PE=3 SV=1 | 141 | 259 | 1.0E-06 |
| sp|Q65P90|RS5_BACLD | 30S ribosomal protein S5 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsE PE=3 SV=1 | 111 | 253 | 1.0E-06 |
| sp|Q1ISA5|RS5_KORVE | 30S ribosomal protein S5 OS=Koribacter versatilis (strain Ellin345) GN=rpsE PE=3 SV=1 | 144 | 254 | 1.0E-06 |
| sp|P23402|RR5_CYAPA | 30S ribosomal protein S5, cyanelle OS=Cyanophora paradoxa GN=rps5 PE=3 SV=1 | 123 | 253 | 1.0E-06 |
| sp|Q13TI7|RS5_BURXL | 30S ribosomal protein S5 OS=Burkholderia xenovorans (strain LB400) GN=rpsE PE=3 SV=1 | 136 | 259 | 1.0E-06 |
| sp|A1RU37|RS5_PYRIL | 30S ribosomal protein S5 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps5 PE=3 SV=1 | 119 | 254 | 2.0E-06 |
| sp|Q1GPB6|RS5_SPHAL | 30S ribosomal protein S5 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsE PE=3 SV=1 | 116 | 253 | 2.0E-06 |
| sp|Q975K0|RS5_SULTO | 30S ribosomal protein S5 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps5 PE=3 SV=1 | 127 | 253 | 2.0E-06 |
| sp|A0PM82|RS5_MYCUA | 30S ribosomal protein S5 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-06 |
| sp|Q1D758|RS5_MYXXD | 30S ribosomal protein S5 OS=Myxococcus xanthus (strain DK 1622) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-06 |
| sp|Q1IX89|RS5_DEIGD | 30S ribosomal protein S5 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-06 |
| sp|A2SPM2|RS5_METLZ | 30S ribosomal protein S5 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps5 PE=3 SV=1 | 119 | 254 | 2.0E-06 |
| sp|A0ALV1|RS5_LISW6 | 30S ribosomal protein S5 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsE PE=3 SV=1 | 144 | 250 | 2.0E-06 |
| sp|Q8Y446|RS5_LISMO | 30S ribosomal protein S5 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsE PE=3 SV=1 | 144 | 250 | 2.0E-06 |
| sp|Q71WG3|RS5_LISMF | 30S ribosomal protein S5 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsE PE=3 SV=1 | 144 | 250 | 2.0E-06 |
| sp|Q6MSP2|RS5_MYCMS | 30S ribosomal protein S5 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpsE PE=3 SV=1 | 123 | 253 | 2.0E-06 |
| sp|P0A4C8|RS5_CHLTR | 30S ribosomal protein S5 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsE PE=3 SV=1 | 144 | 253 | 2.0E-06 |
| sp|Q3KLI5|RS5_CHLTA | 30S ribosomal protein S5 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsE PE=3 SV=1 | 144 | 253 | 2.0E-06 |
| sp|P0A4C9|RS5_CHLMU | 30S ribosomal protein S5 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsE PE=3 SV=1 | 144 | 253 | 2.0E-06 |
| sp|C1DAT4|RS5_LARHH | 30S ribosomal protein S5 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsE PE=3 SV=1 | 166 | 259 | 2.0E-06 |
| sp|B2HCT8|RS5_MYCMM | 30S ribosomal protein S5 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsE PE=3 SV=1 | 144 | 254 | 2.0E-06 |
| sp|Q04G69|RS5_OENOB | 30S ribosomal protein S5 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsE PE=3 SV=1 | 110 | 254 | 2.0E-06 |
| sp|B2T734|RS5_BURPP | 30S ribosomal protein S5 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsE PE=3 SV=1 | 136 | 259 | 2.0E-06 |
| sp|B2JI48|RS5_BURP8 | 30S ribosomal protein S5 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|Q63Q28|RS5_BURPS | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain K96243) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|A3NEG2|RS5_BURP6 | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 668) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|Q3JMT0|RS5_BURP1 | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|A3P096|RS5_BURP0 | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|A1V886|RS5_BURMS | 30S ribosomal protein S5 OS=Burkholderia mallei (strain SAVP1) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|Q62GM2|RS5_BURMA | 30S ribosomal protein S5 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|A2S7J3|RS5_BURM9 | 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|A3MRX1|RS5_BURM7 | 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|A9ADL0|RS5_BURM1 | 30S ribosomal protein S5 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsE PE=3 SV=1 | 136 | 260 | 2.0E-06 |
| sp|Q2SU44|RS5_BURTA | 30S ribosomal protein S5 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsE PE=3 SV=1 | 136 | 259 | 3.0E-06 |
| sp|Q47LL0|RS5_THEFY | 30S ribosomal protein S5 OS=Thermobifida fusca (strain YX) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-06 |
| sp|C0ZW43|RS5_RHOE4 | 30S ribosomal protein S5 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-06 |
| sp|B1MGC5|RS5_MYCA9 | 30S ribosomal protein S5 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-06 |
| sp|Q5Z1Q5|RS5_NOCFA | 30S ribosomal protein S5 OS=Nocardia farcinica (strain IFM 10152) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-06 |
| sp|C1B029|RS5_RHOOB | 30S ribosomal protein S5 OS=Rhodococcus opacus (strain B4) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-06 |
| sp|Q0S3F9|RS5_RHOJR | 30S ribosomal protein S5 OS=Rhodococcus jostii (strain RHA1) GN=rpsE PE=3 SV=1 | 144 | 254 | 3.0E-06 |
| sp|A8F9A2|RS5_BACP2 | 30S ribosomal protein S5 OS=Bacillus pumilus (strain SAFR-032) GN=rpsE PE=3 SV=1 | 129 | 253 | 3.0E-06 |
| sp|Q6HPP1|RS5_BACHK | 30S ribosomal protein S5 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsE PE=3 SV=1 | 111 | 253 | 4.0E-06 |
| sp|Q63H73|RS5_BACCZ | 30S ribosomal protein S5 OS=Bacillus cereus (strain ZK / E33L) GN=rpsE PE=3 SV=1 | 111 | 253 | 4.0E-06 |
| sp|Q73F79|RS5_BACC1 | 30S ribosomal protein S5 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsE PE=3 SV=1 | 111 | 253 | 4.0E-06 |
| sp|Q81VR3|RS5_BACAN | 30S ribosomal protein S5 OS=Bacillus anthracis GN=rpsE PE=3 SV=1 | 111 | 253 | 4.0E-06 |
| sp|Q73S92|RS5_MYCPA | 30S ribosomal protein S5 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-06 |
| sp|P59123|RS5_OCEIH | 30S ribosomal protein S5 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsE PE=3 SV=1 | 110 | 253 | 4.0E-06 |
| sp|C5D3T4|RS5_GEOSW | 30S ribosomal protein S5 OS=Geobacillus sp. (strain WCH70) GN=rpsE PE=3 SV=1 | 111 | 254 | 4.0E-06 |
| sp|A7GK37|RS5_BACCN | 30S ribosomal protein S5 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsE PE=3 SV=1 | 111 | 248 | 4.0E-06 |
| sp|O33000|RS5_MYCLE | 30S ribosomal protein S5 OS=Mycobacterium leprae (strain TN) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-06 |
| sp|B8ZSA2|RS5_MYCLB | 30S ribosomal protein S5 OS=Mycobacterium leprae (strain Br4923) GN=rpsE PE=3 SV=1 | 144 | 254 | 4.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005840 | ribosome | Yes |
| GO:0006412 | translation | Yes |
| GO:0003735 | structural constituent of ribosome | Yes |
| GO:0003723 | RNA binding | Yes |
| GO:0009059 | macromolecule biosynthetic process | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0019538 | protein metabolic process | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:0044260 | cellular macromolecule metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0005488 | binding | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0009987 | cellular process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0003676 | nucleic acid binding | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0008152 | metabolic process | No |
| GO:0043228 | non-membrane-bounded organelle | No |
| GO:0003674 | molecular_function | No |
| GO:0005575 | cellular_component | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0006518 | peptide metabolic process | No |
| GO:1901566 | organonitrogen compound biosynthetic process | No |
| GO:0005198 | structural molecule activity | No |
| GO:0043232 | intracellular non-membrane-bounded organelle | No |
| GO:0008150 | biological_process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0043603 | cellular amide metabolic process | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0043604 | amide biosynthetic process | No |
| GO:0043226 | organelle | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0034645 | cellular macromolecule biosynthetic process | No |
| GO:0043043 | peptide biosynthetic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0043229 | intracellular organelle | No |
| GO:0009058 | biosynthetic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 17 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|107410 MYRILRPRLFSSLSSSEPSFPIPARRPKDPQPPSEGESDGNGRPPSLLDASPLDARDVLDFPPTPNFLGGRVIVR NHISIFDDLPSPTPSSSSSSSPPPESTSATRASLHLSPSEIKSLYSTILLSRTVKQQTPKGKIARKQFLVCVGNG NGLIGYGSSTDSDSRLALTKARTKAIQNMDYVSLYEQRTIWTELSTKLGATRIIMRPRPVGFGLRCNPFIHQILR ATGFKDVSAKVWGSRNKLNVVKAVFRMLQAGHAPTGMGDGVGGKGIKLSKGVGMRGMEELERARGRKLIGLRK* |
| Coding | >Agabi119p4|107410 ATGTACCGGATTCTGCGCCCGCGTTTGTTCTCCTCGCTGTCCAGTTCAGAACCTTCGTTTCCCATTCCTGCACGA CGACCAAAGGACCCACAACCTCCTTCAGAGGGTGAATCCGACGGAAATGGACGCCCGCCGAGTCTTTTGGATGCT TCTCCCTTGGACGCCCGAGACGTCCTCGACTTTCCTCCAACTCCCAATTTTCTCGGTGGACGCGTCATCGTCCGC AACCACATCTCCATCTTTGACGACCTTCCCTCTCCCACCCCTTCCTCCTCCTCATCCTCTTCACCTCCACCCGAA TCCACATCAGCCACCCGCGCCTCCCTCCACCTCTCCCCCTCCGAAATCAAATCCCTCTACTCCACCATCCTCCTC TCCCGCACCGTCAAACAACAAACCCCCAAAGGTAAAATCGCCCGCAAACAATTCCTAGTCTGCGTCGGTAACGGT AACGGTCTCATCGGCTACGGTTCCTCCACCGATTCCGATTCCCGTCTCGCCCTCACCAAAGCTCGTACCAAAGCC ATCCAAAACATGGATTACGTCTCTCTCTACGAACAACGTACCATCTGGACCGAATTATCCACTAAATTAGGTGCA ACACGTATCATCATGCGTCCTCGTCCTGTTGGTTTCGGGTTACGCTGTAATCCATTTATACATCAGATTTTGAGG GCGACGGGGTTTAAGGATGTGAGTGCGAAGGTGTGGGGGAGTAGGAATAAGTTGAATGTCGTCAAGGCGGTGTTT AGGATGTTGCAGGCGGGTCATGCGCCGACGGGGATGGGGGATGGTGTGGGTGGGAAAGGGATCAAGTTGAGTAAG GGTGTGGGGATGAGGGGGATGGAGGAGTTGGAAAGAGCGAGAGGGAGGAAGTTGATTGGTTTGCGCAAGTAG |
| Transcript | >Agabi119p4|107410 ATGTACCGGATTCTGCGCCCGCGTTTGTTCTCCTCGCTGTCCAGTTCAGAACCTTCGTTTCCCATTCCTGCACGA CGACCAAAGGACCCACAACCTCCTTCAGAGGGTGAATCCGACGGAAATGGACGCCCGCCGAGTCTTTTGGATGCT TCTCCCTTGGACGCCCGAGACGTCCTCGACTTTCCTCCAACTCCCAATTTTCTCGGTGGACGCGTCATCGTCCGC AACCACATCTCCATCTTTGACGACCTTCCCTCTCCCACCCCTTCCTCCTCCTCATCCTCTTCACCTCCACCCGAA TCCACATCAGCCACCCGCGCCTCCCTCCACCTCTCCCCCTCCGAAATCAAATCCCTCTACTCCACCATCCTCCTC TCCCGCACCGTCAAACAACAAACCCCCAAAGGTAAAATCGCCCGCAAACAATTCCTAGTCTGCGTCGGTAACGGT AACGGTCTCATCGGCTACGGTTCCTCCACCGATTCCGATTCCCGTCTCGCCCTCACCAAAGCTCGTACCAAAGCC ATCCAAAACATGGATTACGTCTCTCTCTACGAACAACGTACCATCTGGACCGAATTATCCACTAAATTAGGTGCA ACACGTATCATCATGCGTCCTCGTCCTGTTGGTTTCGGGTTACGCTGTAATCCATTTATACATCAGATTTTGAGG GCGACGGGGTTTAAGGATGTGAGTGCGAAGGTGTGGGGGAGTAGGAATAAGTTGAATGTCGTCAAGGCGGTGTTT AGGATGTTGCAGGCGGGTCATGCGCCGACGGGGATGGGGGATGGTGTGGGTGGGAAAGGGATCAAGTTGAGTAAG GGTGTGGGGATGAGGGGGATGGAGGAGTTGGAAAGAGCGAGAGGGAGGAAGTTGATTGGTTTGCGCAAGTAG |
| Gene | >Agabi119p4|107410 ATGTACCGGATTCTGCGCCCGCGTTTGTTCTCCTCGCTGTCCAGTTCAGAACCTTCGTTTCCCATTCCTGCACGA CGACCAAAGGACCCACAACCTCCTTCAGGCAAGTTTCTCTTGAACGACTTGTCTACTTTTGAATAACACACCACA GAGGGTGAATCCGACGGAAATGGACGCCCGCCGAGTCTTTTGGATGCTTCTCCCTTGGACGCCCGAGACGTCCTC GACTTTCCTCCAACTCCCAATTTTCTCGGTGGACGCGTCATCGTCCGCAACCACATCTCCATCTTTGACGACCTT CCCTCTCCCACCCCTTCCTCCTCCTCATCCTCTTCACCTCCACCCGAATCCACATCAGCCACCCGCGCCTCCCTC CACCTCTCCCCCTCCGAAATCAAATCCCTCTACTCCACCATCCTCCTCTCCCGCACCGTCAAACAACAAACCCCC AAAGGTAAAATCGCCCGCAAACAATTCCTAGTCTGCGTCGGTAACGGTAACGGTCTCATCGGCTACGGTTCCTCC ACCGATTCCGATTCCCGTCTCGCCCTCACCAAAGCTCGTACCAAAGCCATCCAAAACATGGATTACGTCTCTCTC TACGAACAACGTACCATCTGGACCGAATTATCCACTAAATTAGGTGCAACACGTATCATCATGCGTCCTCGTCCT GTTGGTTTCGGGTTACGCTGTAATCCATTTATACATCAGATTTTGAGGGCGACGGGGTTTAAGGATGTGAGTGCG AAGGTGTGGGGGAGTAGGAATAAGTTGAATGTCGTCAAGGCGGTGTTTAGGATGTTGCAGGCGGGTCATGCGCCG ACGGGGATGGGGGATGGTGTGGGTGGGAAAGGGATCAAGTTGAGTAAGGGTGTGGGGATGAGGGGGATGGAGGAG TTGGAAAGAGCGAGAGGGAGGAAGTTGATTGGTTTGCGCAAGTAG |