Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|106350
Gene name
Locationscaffold_08:28066..29788
Strand+
Gene length (bp)1722
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase 9.1E-66 25 264
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 1.4E-12 310 436

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P9|PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkp1 PE=3 SV=1 7 445 9.0E-129
sp|Q9SBJ1|PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana GN=PDK PE=1 SV=1 168 446 4.0E-79
sp|P91622|PDK_DROME [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Drosophila melanogaster GN=Pdk PE=2 SV=2 181 446 7.0E-65
sp|Q922H2|PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus GN=Pdk3 PE=1 SV=1 173 446 1.0E-63
sp|Q15120|PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens GN=PDK3 PE=1 SV=1 173 446 3.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P9|PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkp1 PE=3 SV=1 7 445 9.0E-129
sp|Q9SBJ1|PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana GN=PDK PE=1 SV=1 168 446 4.0E-79
sp|P91622|PDK_DROME [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Drosophila melanogaster GN=Pdk PE=2 SV=2 181 446 7.0E-65
sp|Q922H2|PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus GN=Pdk3 PE=1 SV=1 173 446 1.0E-63
sp|Q15120|PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens GN=PDK3 PE=1 SV=1 173 446 3.0E-63
sp|Q9JK42|PDK2_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Mus musculus GN=Pdk2 PE=1 SV=2 179 446 3.0E-62
sp|Q64536|PDK2_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Rattus norvegicus GN=Pdk2 PE=1 SV=1 179 446 2.0E-61
sp|Q15119|PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens GN=PDK2 PE=1 SV=2 179 446 3.0E-61
sp|O02623|PDK_ASCSU [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Ascaris suum PE=2 SV=1 183 438 1.0E-60
sp|O88345|PDK4_ICTTR [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Ictidomys tridecemlineatus GN=PDK4 PE=2 SV=1 179 446 6.0E-60
sp|Q1KMR4|PDK4_RHIFE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rhinolophus ferrumequinum GN=PDK4 PE=2 SV=1 179 446 6.0E-59
sp|Q63065|PDK1_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Rattus norvegicus GN=Pdk1 PE=1 SV=1 188 446 1.0E-58
sp|Q15118|PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens GN=PDK1 PE=1 SV=1 188 446 4.0E-58
sp|Q16654|PDK4_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Homo sapiens GN=PDK4 PE=1 SV=1 179 446 5.0E-58
sp|Q8BFP9|PDK1_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus GN=Pdk1 PE=1 SV=2 188 446 8.0E-58
sp|Q02332|PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans GN=pdhk-2 PE=3 SV=1 178 436 1.0E-57
sp|O70571|PDK4_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Mus musculus GN=Pdk4 PE=1 SV=1 179 446 2.0E-57
sp|O54937|PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus GN=Pdk4 PE=1 SV=1 179 446 4.0E-56
sp|Q2KJG8|BCKD_BOVIN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Bos taurus GN=BCKDK PE=2 SV=1 175 443 4.0E-43
sp|O55028|BCKD_MOUSE [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Mus musculus GN=Bckdk PE=1 SV=1 175 443 2.0E-42
sp|Q00972|BCKD_RAT [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Rattus norvegicus GN=Bckdk PE=1 SV=2 175 443 4.0E-42
sp|O14874|BCKD_HUMAN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens GN=BCKDK PE=1 SV=2 175 443 4.0E-42
sp|P40530|PDK1_YEAST [Pyruvate dehydrogenase (acetyl-transferring)] kinase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKP1 PE=1 SV=1 178 435 2.0E-17
sp|Q9SBJ1|PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana GN=PDK PE=1 SV=1 10 147 6.0E-17
sp|O02623|PDK_ASCSU [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Ascaris suum PE=2 SV=1 8 104 4.0E-13
sp|Q1KMR4|PDK4_RHIFE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rhinolophus ferrumequinum GN=PDK4 PE=2 SV=1 14 109 3.0E-12
sp|Q02332|PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans GN=pdhk-2 PE=3 SV=1 10 103 9.0E-12
sp|Q16654|PDK4_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Homo sapiens GN=PDK4 PE=1 SV=1 14 109 1.0E-11
sp|Q8BFP9|PDK1_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus GN=Pdk1 PE=1 SV=2 14 95 5.0E-11
sp|Q63065|PDK1_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Rattus norvegicus GN=Pdk1 PE=1 SV=1 14 95 6.0E-11
sp|Q15118|PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens GN=PDK1 PE=1 SV=1 14 95 6.0E-11
sp|O70571|PDK4_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Mus musculus GN=Pdk4 PE=1 SV=1 14 109 1.0E-10
sp|O54937|PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus GN=Pdk4 PE=1 SV=1 14 109 3.0E-10
sp|O88345|PDK4_ICTTR [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Ictidomys tridecemlineatus GN=PDK4 PE=2 SV=1 14 95 6.0E-10
sp|Q15120|PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens GN=PDK3 PE=1 SV=1 14 108 8.0E-10
sp|Q922H2|PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus GN=Pdk3 PE=1 SV=1 14 95 8.0E-10
sp|Q15119|PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens GN=PDK2 PE=1 SV=2 15 95 3.0E-09
sp|Q64536|PDK2_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Rattus norvegicus GN=Pdk2 PE=1 SV=1 15 95 3.0E-09
sp|Q9JK42|PDK2_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Mus musculus GN=Pdk2 PE=1 SV=2 15 95 4.0E-09
sp|P91622|PDK_DROME [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Drosophila melanogaster GN=Pdk PE=2 SV=2 18 106 1.0E-08
sp|O55028|BCKD_MOUSE [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Mus musculus GN=Bckdk PE=1 SV=1 19 145 3.0E-07
sp|Q2KJG8|BCKD_BOVIN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Bos taurus GN=BCKDK PE=2 SV=1 19 145 4.0E-07
sp|Q00972|BCKD_RAT [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Rattus norvegicus GN=Bckdk PE=1 SV=2 19 112 4.0E-07
sp|O14874|BCKD_HUMAN [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens GN=BCKDK PE=1 SV=2 19 112 5.0E-07
sp|P53170|PDK2_YEAST [Pyruvate dehydrogenase (acetyl-transferring)] kinase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKP2 PE=1 SV=3 236 445 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|106350
MSAGFRISPALWDKVHHFASFPQTGVSLQQMVLFGRNPCQGTLLKASQFLAEELPVRLAHRVKELDELPHDLSRM
PSIKKVKNWYAQSFEELINFSAIQLSPDVRQALAMPRSGEATLPESIPNPTFEPSGEFLHTHSLETTFSSGNTTG
NGNGFNKLRLRVPMERRYYASTNQSKWPPEVQDYNQRFTKLLEHIKTRHDPTVTTVAQGVLEWKHSQNARHIGHD
IQAWLDRFYLSRIGIRFLIGQHVALNNQQPHEDYVGIICTKANVHDIVQEAIENARFVCEEHYAMFKGPPVQLIC
PKNLNFPYVPGHLSHIVFELLKNSLRAVVERYGVDKEDFPPIKVVVVEGKEDITIKISDEGGGIPRSAIPLIWTY
MYTTMEGQRIDQDFQASDFKAPMAGFGYGLPLSRLYARYFGGDLRLIAMDGFGTDVYIHLNRLSSSREPLP*
Coding >Agabi119p4|106350
ATGTCCGCAGGATTCCGCATTTCCCCTGCGCTTTGGGACAAAGTCCACCATTTCGCCTCCTTTCCACAGACCGGA
GTATCTCTCCAGCAGATGGTCTTGTTCGGCAGAAACCCATGTCAGGGGACTCTGTTAAAGGCTAGCCAGTTCCTC
GCAGAGGAGCTCCCAGTACGCCTCGCTCACCGCGTCAAGGAGCTAGACGAGTTACCTCATGACCTCAGCCGCATG
CCATCTATCAAGAAAGTCAAGAACTGGTACGCTCAGTCTTTCGAGGAACTCATCAATTTCTCCGCCATCCAACTT
TCGCCCGACGTCCGTCAGGCCCTGGCGATGCCCCGATCAGGAGAGGCTACCCTCCCAGAATCGATACCTAACCCG
ACATTCGAGCCCTCGGGTGAATTCCTGCACACTCATTCCTTGGAAACAACTTTCTCTTCTGGAAATACCACGGGA
AATGGGAATGGTTTCAACAAGCTCAGGTTGCGGGTCCCCATGGAACGGAGGTACTACGCGAGTACCAATCAGTCC
AAATGGCCTCCCGAGGTTCAGGACTACAATCAGCGGTTTACCAAACTCCTCGAACACATCAAGACCCGTCATGAT
CCGACAGTGACAACGGTCGCTCAGGGTGTTTTAGAATGGAAACACTCACAGAATGCCCGTCACATCGGGCATGAC
ATTCAGGCTTGGTTGGATCGATTCTATCTCTCACGGATCGGCATCCGTTTTCTAATTGGCCAACACGTCGCTTTG
AATAATCAGCAGCCACACGAAGACTATGTCGGTATCATCTGCACCAAAGCCAATGTCCACGATATTGTCCAAGAA
GCCATCGAGAATGCTCGATTCGTGTGCGAAGAACACTACGCCATGTTCAAGGGTCCACCCGTACAACTTATCTGT
CCCAAAAACTTGAATTTCCCCTATGTTCCAGGCCATCTGTCTCACATTGTCTTTGAACTCCTCAAAAACTCTTTA
CGTGCCGTGGTTGAGCGTTACGGGGTCGACAAGGAAGATTTCCCGCCTATCAAAGTCGTCGTTGTAGAAGGCAAG
GAAGACATCACCATCAAGATCTCCGACGAGGGGGGTGGCATTCCTCGCAGTGCTATTCCCCTTATTTGGACGTAT
ATGTACACCACCATGGAAGGTCAACGCATTGATCAAGATTTTCAAGCTAGTGATTTCAAAGCTCCCATGGCCGGT
TTCGGTTATGGTCTCCCGTTGTCAAGATTGTATGCTCGTTATTTCGGAGGGGATCTCCGGTTGATTGCTATGGAT
GGGTTTGGTACTGATGTGTATATTCATTTGAATCGGCTGTCAAGCAGTCGAGAACCTCTTCCTTGA
Transcript >Agabi119p4|106350
ATGTCCGCAGGATTCCGCATTTCCCCTGCGCTTTGGGACAAAGTCCACCATTTCGCCTCCTTTCCACAGACCGGA
GTATCTCTCCAGCAGATGGTCTTGTTCGGCAGAAACCCATGTCAGGGGACTCTGTTAAAGGCTAGCCAGTTCCTC
GCAGAGGAGCTCCCAGTACGCCTCGCTCACCGCGTCAAGGAGCTAGACGAGTTACCTCATGACCTCAGCCGCATG
CCATCTATCAAGAAAGTCAAGAACTGGTACGCTCAGTCTTTCGAGGAACTCATCAATTTCTCCGCCATCCAACTT
TCGCCCGACGTCCGTCAGGCCCTGGCGATGCCCCGATCAGGAGAGGCTACCCTCCCAGAATCGATACCTAACCCG
ACATTCGAGCCCTCGGGTGAATTCCTGCACACTCATTCCTTGGAAACAACTTTCTCTTCTGGAAATACCACGGGA
AATGGGAATGGTTTCAACAAGCTCAGGTTGCGGGTCCCCATGGAACGGAGGTACTACGCGAGTACCAATCAGTCC
AAATGGCCTCCCGAGGTTCAGGACTACAATCAGCGGTTTACCAAACTCCTCGAACACATCAAGACCCGTCATGAT
CCGACAGTGACAACGGTCGCTCAGGGTGTTTTAGAATGGAAACACTCACAGAATGCCCGTCACATCGGGCATGAC
ATTCAGGCTTGGTTGGATCGATTCTATCTCTCACGGATCGGCATCCGTTTTCTAATTGGCCAACACGTCGCTTTG
AATAATCAGCAGCCACACGAAGACTATGTCGGTATCATCTGCACCAAAGCCAATGTCCACGATATTGTCCAAGAA
GCCATCGAGAATGCTCGATTCGTGTGCGAAGAACACTACGCCATGTTCAAGGGTCCACCCGTACAACTTATCTGT
CCCAAAAACTTGAATTTCCCCTATGTTCCAGGCCATCTGTCTCACATTGTCTTTGAACTCCTCAAAAACTCTTTA
CGTGCCGTGGTTGAGCGTTACGGGGTCGACAAGGAAGATTTCCCGCCTATCAAAGTCGTCGTTGTAGAAGGCAAG
GAAGACATCACCATCAAGATCTCCGACGAGGGGGGTGGCATTCCTCGCAGTGCTATTCCCCTTATTTGGACGTAT
ATGTACACCACCATGGAAGGTCAACGCATTGATCAAGATTTTCAAGCTAGTGATTTCAAAGCTCCCATGGCCGGT
TTCGGTTATGGTCTCCCGTTGTCAAGATTGTATGCTCGTTATTTCGGAGGGGATCTCCGGTTGATTGCTATGGAT
GGGTTTGGTACTGATGTGTATATTCATTTGAATCGGCTGTCAAGCAGTCGAGAACCTCTTCCTTGA
Gene >Agabi119p4|106350
ATGTCCGCAGGATTCCGCATTTCCCCTGCGCTTTGGGACAAAGTCCACCATTTCGCCTCCTTTCCACAGACCGGA
GGTGCGTCTCTGCCATCCACGCCTGACCACATTCCTCACCCAATTCTGTGCAGTATCTCTCCAGCAGATGGTCTT
GTTCGGCAGAAACCCATGTCAGGGGACTCTGTTAAAGGCTAGCCAGTTCCTCGCAGGTGCAAAGACTACTCTATC
CCATATATCATTCTGCTCACACGACCCCATTTATTGACTCAGAGGAGCTCCCAGTACGCCTCGCTCACCGCGTCA
AGGAGCTAGACGAGTTACCTCATGACCTCAGCCGCATGCCATCTATCAAGAAAGTCAAGAACTGGTACGCTCAGT
CTTTCGAGGTCTGCGAGTCCCTTTTCCAATTCTCTCCGATTATGACTCATCCTTCACCTCAGGAACTCATCAATT
TCTCCGCCATCCAACTTTCGCCCGACGTCCGTCAGGCCCTGGCGATGCCCCGATCAGGAGAGGCTACCCTCCCAG
AATCGATACCTAACCCGACATTCGAGCCCTCGGGTGAATTCCTGCACACTCATTCCTTGGAAACAACTTTCTCTT
CTGGAAATACCACGGGAAATGGGAATGGTTTCAACAAGCTCAGGTTGCGGGTCCCCATGGAACGGAGGTAAGTCC
CGACTTTTCGCGCATCTAGTCCGAAATGTCGTCATTAACCCTTTTGGGAAGGTACTACGCGAGTACCAATCAGTC
CAAATGGCCTCCCGAGGTTCAGGACTACAATCAGCGGTTTACCAAACTCCTCGAACACATCAAGACCCGTCATGA
TCCGACAGTGACAACGGTCGCTCAGGGTGTTTTAGAATGGAAACACTCACAGAATGCCCGTCACATCGGGCATGA
CATTCAGGCTTGGTTGGATCGATTCTATCTCTCACGGATCGGCATCCGTTTTCTAATTGGCCAACGTACGTCATT
CACTACCAGTGATGGGAGCATCTCACATTCTTCAAAAGACGTCGCTTTGAATAATCAGCAGCCACACGAAGACTA
TGTCGGTATCATCTGCACCAAAGCCGTACGTCTTTACTTTGGCTGGCTCGTTATCAAAGACTCAACTCTTGCCCG
CAGAATGTCCACGATATTGTCCAAGAAGCCATCGAGAATGCTCGATTCGTGTGCGAAGAACACTACGCCATGTTC
AAGGGTCCACCCGTACAACTTATCTGTCCCAAAAACTTGAATTTCCCCTATGTTCCAGGCCATCTGTCTCACATT
GTCTTTGAACTCCTCAAAAACTCTTTACGTGCCGTGGTTGAGCGTTACGGGGTCGACAAGGAAGATTTCCCGCCT
ATCAAAGTCGTCGTTGTAGAAGGCAAGGAAGACATCACCATCAAGATCTCCGACGAGGGGGGTGGCATTCCTCGC
AGTGCTATTCCCCTTATTTGGACGTATATGTACACCACCATGGAAGGTCAACGCATTGATCAAGATTTTCAAGCT
AGTGATTTCAAAGCTCCCATGGCCGGTTTCGGTTATGGTCTCCCGTTGTCAAGATTGGTGTGTTTTCACATTCTC
GCTCACTCCGCTATCCGCTTATTGATACTATTCCAGTATGCTCGTTATTTCGGAGGGGATCTCCGGTTGATTGCT
ATGGATGGGTTTGGTACTGATGTGTATATTCATTTGAATCGGCTGTCAAGCAGTCGAGAACCTCTTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail