Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|105950
Gene name
Locationscaffold_07:2173639..2175223
Strand+
Gene length (bp)1584
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O51055|Y024_BORBU Uncharacterized protein BB_0024 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0024 PE=4 SV=1 13 380 6.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|105950
MRASLFLFLSLPVFILAQIQSDGANFLSPVTVAPGLDASVIFSNLTSPRGVAIDSEQNLLVVERGVGVSAFTRVS
AGWSRTVVIKNDQLTHGIQIDSSTLYVSTASEVLAYSYDPATQVASSQGSAIIANLPPDGELTTHTLQLARDNSG
LVTAILVGSGPKTNIDITARDPASGRSQIRSFSLLTKQPWPLNWENGVVVAYGIRNPAGFAFVPSPQVGPVASQT
LLVVENAPSIDNVTGLTAAFANDNPADEIESVTIPTIGNTTPASFGFPDCATLWNGAADPTGVPQYEDSPRGTQF
SLNLPSLSTPLPRLDPWCQNTTNNHPPAFNFQAHSVPLDIKRYEPQPIGVGGGLPGEWSGDVFVSFHGSFDRTPP
TGYGVVHVPYPFEPLSTSPLGYDFLVQATDLNTCPGRCIRPAGLVFGRDNRLYVTSDSSGELFVIRGSAVSPSSS
IG*
Coding >Agabi119p4|105950
ATGAGGGCCTCTTTATTTCTCTTCCTCAGTCTTCCGGTCTTCATTCTAGCTCAAATCCAATCCGATGGAGCCAAC
TTTCTATCACCAGTGACCGTTGCGCCTGGTCTCGATGCTTCAGTCATCTTTTCCAACCTCACCAGTCCCCGTGGT
GTCGCTATCGACTCTGAACAAAACTTGCTCGTAGTTGAGCGTGGAGTTGGGGTTTCTGCGTTTACGAGAGTTTCC
GCTGGATGGAGTCGCACAGTTGTCATCAAAAATGATCAGCTGACCCACGGTATTCAGATTGATTCGAGCACGCTC
TATGTCAGCACTGCTTCAGAAGTCTTGGCTTACTCTTATGATCCTGCCACTCAAGTAGCTTCGAGCCAAGGGAGC
GCTATTATCGCGAATTTACCCCCTGACGGAGAGTTGACGACGCATACTCTACAGTTGGCACGCGATAATTCCGGT
TTGGTAACTGCTATCCTTGTCGGTTCTGGCCCCAAAACCAACATCGATATCACTGCTCGCGATCCCGCCTCCGGT
CGATCTCAAATTCGTTCTTTTTCCCTTCTCACAAAGCAACCTTGGCCTCTGAATTGGGAAAATGGGGTTGTTGTC
GCTTATGGGATTCGTAATCCAGCAGGTTTTGCATTCGTCCCCTCCCCTCAAGTTGGTCCTGTTGCTTCTCAAACC
CTGCTCGTTGTTGAAAATGCCCCTTCCATCGATAATGTGACGGGATTGACTGCAGCATTTGCAAATGATAATCCG
GCTGACGAAATTGAGAGTGTTACGATACCCACTATCGGTAACACTACTCCAGCCTCTTTTGGATTCCCCGACTGT
GCCACTCTTTGGAATGGTGCAGCTGATCCCACTGGTGTACCACAGTACGAAGATTCTCCTCGTGGCACACAGTTC
AGTCTGAATCTACCTTCGTTGTCAACGCCACTTCCTCGCCTCGATCCTTGGTGCCAAAATACGACAAACAATCAT
CCCCCGGCTTTCAACTTCCAGGCTCACTCCGTTCCTCTCGATATCAAACGATACGAACCTCAACCAATTGGCGTT
GGTGGAGGACTCCCCGGAGAGTGGTCTGGAGACGTTTTTGTCTCTTTCCACGGTTCTTTTGACAGGACTCCTCCT
ACCGGCTACGGTGTAGTCCATGTACCATACCCATTTGAACCTCTCTCAACTTCCCCCTTGGGCTATGACTTCCTT
GTCCAAGCTACGGATCTCAATACCTGTCCAGGAAGGTGTATCCGACCTGCTGGTTTAGTCTTTGGTCGAGATAAT
AGACTGTATGTTACGAGTGATAGTAGCGGAGAGTTGTTTGTTATCCGGGGCTCGGCGGTAAGCCCCTCTTCGAGT
ATTGGATAG
Transcript >Agabi119p4|105950
ATGAGGGCCTCTTTATTTCTCTTCCTCAGTCTTCCGGTCTTCATTCTAGCTCAAATCCAATCCGATGGAGCCAAC
TTTCTATCACCAGTGACCGTTGCGCCTGGTCTCGATGCTTCAGTCATCTTTTCCAACCTCACCAGTCCCCGTGGT
GTCGCTATCGACTCTGAACAAAACTTGCTCGTAGTTGAGCGTGGAGTTGGGGTTTCTGCGTTTACGAGAGTTTCC
GCTGGATGGAGTCGCACAGTTGTCATCAAAAATGATCAGCTGACCCACGGTATTCAGATTGATTCGAGCACGCTC
TATGTCAGCACTGCTTCAGAAGTCTTGGCTTACTCTTATGATCCTGCCACTCAAGTAGCTTCGAGCCAAGGGAGC
GCTATTATCGCGAATTTACCCCCTGACGGAGAGTTGACGACGCATACTCTACAGTTGGCACGCGATAATTCCGGT
TTGGTAACTGCTATCCTTGTCGGTTCTGGCCCCAAAACCAACATCGATATCACTGCTCGCGATCCCGCCTCCGGT
CGATCTCAAATTCGTTCTTTTTCCCTTCTCACAAAGCAACCTTGGCCTCTGAATTGGGAAAATGGGGTTGTTGTC
GCTTATGGGATTCGTAATCCAGCAGGTTTTGCATTCGTCCCCTCCCCTCAAGTTGGTCCTGTTGCTTCTCAAACC
CTGCTCGTTGTTGAAAATGCCCCTTCCATCGATAATGTGACGGGATTGACTGCAGCATTTGCAAATGATAATCCG
GCTGACGAAATTGAGAGTGTTACGATACCCACTATCGGTAACACTACTCCAGCCTCTTTTGGATTCCCCGACTGT
GCCACTCTTTGGAATGGTGCAGCTGATCCCACTGGTGTACCACAGTACGAAGATTCTCCTCGTGGCACACAGTTC
AGTCTGAATCTACCTTCGTTGTCAACGCCACTTCCTCGCCTCGATCCTTGGTGCCAAAATACGACAAACAATCAT
CCCCCGGCTTTCAACTTCCAGGCTCACTCCGTTCCTCTCGATATCAAACGATACGAACCTCAACCAATTGGCGTT
GGTGGAGGACTCCCCGGAGAGTGGTCTGGAGACGTTTTTGTCTCTTTCCACGGTTCTTTTGACAGGACTCCTCCT
ACCGGCTACGGTGTAGTCCATGTACCATACCCATTTGAACCTCTCTCAACTTCCCCCTTGGGCTATGACTTCCTT
GTCCAAGCTACGGATCTCAATACCTGTCCAGGAAGGTGTATCCGACCTGCTGGTTTAGTCTTTGGTCGAGATAAT
AGACTGTATGTTACGAGTGATAGTAGCGGAGAGTTGTTTGTTATCCGGGGCTCGGCGGTAAGCCCCTCTTCGAGT
ATTGGATAG
Gene >Agabi119p4|105950
ATGAGGGCCTCTTTATTTCTCTTCCTCAGTCTTCCGGTCTTCATTCTAGCTCAAATCCAATCCGATGGAGCCAAC
TTTCTATCACCAGTGACCGTTGCGCCTGGTCTCGATGCTTCAGTCATCTTTTCCAACCTCACCAGTCCCCGTGGT
GTCGCTATCGACTCTGAACAAAACTTGCTCGTAGTTGAGCGTGGAGTTGGGGTTTCTGCGTTTACGAGAGTTTCC
GCTGGATGGAGTCGCACAGTTGTCATCAAAAATGATCAGCTGACCCACGGTATTCAGATTGATTCGAGCACGCTC
TATGTCAGCACTGCTTCAGAAGTCTTGGCTTACTCTTATGATCCTGCCACTCAAGTAGCTTCGAGCCAAGGGAGC
GCTATTATCGCGAATTTACCCCCTGACGGAGGTCGGTGTTCAATGATTCACTAGCCGAAAACTAATTCATTCTTC
CATCTTCGCAGAGTTGACGACGCATACTCTACAGTTGGCACGCGATAATTCCGGTTTGGTAACTGCTATCCTTGT
CGGTTCTGGCCCCAAAACCAACATCGATATCACTGCTCGCGATCCCGCCTCCGGTCGATCTCAAATTCGTTCTTT
TTCCCTTCTCACAAAGCAACCTTGGCCTCTGAATTGGGAAAATGGGGTTGTTGTCGCTTATGGGATTCGTAATCC
AGCAGGTTTTGCATTCGTCCCCTCCCCTCAAGTTGGTCCTGTTGCTTCTCAAACCCTGCTCGTTGTTGAAAATGC
CCCTTCCATCGATAATGTGACGGGATTGACTGCAGCATTTGCAAATGATAATCCGGCTGACGAAATTGAGAGTGT
TACGATACCCACTATCGGTAACACTACTCCAGCCTCTTTTGGATTCCCCGACTGTGCCACTCTTTGGAATGGTGC
AGCTGATCCCACTGGTGTACCACAGTACGAAGATTCTCCTCGTGGCACACAGTTCAGTCTGAATCTACCTTCGTT
GTCAACGCCACTTCCTCGCCTCGATCCTTGGTGCCAAAATACGACAAACAATCATCCCCCGGCTTTCAACTTCCA
GGTAACGATTTATGTATCAAATATTGGATTATATATAACTCTTTATATAGGCTCACTCCGTTCCTCTCGATATCA
AACGATACGAACCTCAACCAATTGGCGTTGGTGGAGGACTCCCCGGAGAGTGGTCTGGAGACGTTTTTGTCTCTT
TCCACGGTTCTTTTGACAGGACTCCTCCTACCGGCTACGGTGTAGTCCAGTACGCTTTCAACTTTTACAATTGAA
GGATATTGAGCTCATTGATTGATTGACATCAGTGTACCATACCCATTTGAACCTCTCTCAACTTCCCCCTTGGGC
TATGACTTCCTTGTCCAAGCTACGGATCTCAATACCTGTCCAGGAAGGTGTATCCGACCTGCTGGTTTAGTCTTT
GGTCGAGATAATAGACTGTATGTTACGAGTGATAGTAGCGGAGAGGTACGTTTGGTCTCGCGTTGAAGTTTTGGC
CTGATTTTGCTGACATGATGTTAAAAATAATAGTTGTTTGTTATCCGGGGCTCGGCGGTAAGCCCCTCTTCGAGT
ATTGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail