Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|105380
Gene name
Locationscaffold_07:2000967..2003201
Strand+
Gene length (bp)2234
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 1.4E-37 74 441

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 66 440 3.0E-21
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 59 440 2.0E-19
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 40 440 3.0E-19
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 33 440 8.0E-19
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 4 440 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 66 440 3.0E-21
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 59 440 2.0E-19
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 40 440 3.0E-19
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 33 440 8.0E-19
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 4 440 1.0E-18
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 87 440 1.0E-18
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 66 440 1.0E-18
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 19 440 2.0E-18
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 5 440 2.0E-18
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 40 440 3.0E-18
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 40 440 3.0E-18
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 40 440 4.0E-18
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 66 440 4.0E-18
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 68 440 6.0E-18
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 52 440 8.0E-18
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 40 440 1.0E-17
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 40 440 1.0E-17
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 5 440 3.0E-17
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 55 440 4.0E-17
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 87 440 4.0E-17
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 40 440 1.0E-16
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 45 440 1.0E-16
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 87 440 3.0E-16
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 87 440 4.0E-16
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 66 440 5.0E-16
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 8 440 8.0E-16
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 50 440 1.0E-15
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 87 440 3.0E-15
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 66 458 4.0E-15
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 87 440 1.0E-14
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 66 458 2.0E-14
sp|P27823|PEPAF_RABIT Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 66 440 2.0E-14
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 8 440 2.0E-14
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 43 440 2.0E-14
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 87 440 3.0E-14
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 66 464 6.0E-14
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 4 440 8.0E-14
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 87 472 3.0E-13
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 8 436 6.0E-13
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 87 440 2.0E-12
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 65 440 2.0E-12
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 66 440 2.0E-12
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 87 440 3.0E-12
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 66 355 4.0E-12
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 7 436 6.0E-12
sp|P24268|CATD_RAT Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1 66 436 2.0E-11
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 87 440 2.0E-11
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 66 440 4.0E-11
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 66 440 6.0E-11
sp|E5R1B9|PEPA_ARTGP Aspartic protease PEP1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=PEP1 PE=3 SV=1 69 453 9.0E-11
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 66 440 2.0E-10
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 5 440 2.0E-10
sp|Q4WFS2|Y1220_ASPFU Probable aspartic-type endopeptidase AFUA_3G01220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G01220 PE=3 SV=2 74 405 3.0E-10
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 73 440 3.0E-10
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 66 440 4.0E-10
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 66 355 4.0E-10
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 66 436 7.0E-10
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 87 352 8.0E-10
sp|P39898|PLM1_PLAFA Plasmepsin-1 OS=Plasmodium falciparum PE=1 SV=2 48 442 1.0E-09
sp|Q7KQM4|PLM1_PLAF7 Plasmepsin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0076 PE=2 SV=1 48 442 1.0E-09
sp|P80209|CATD_BOVIN Cathepsin D OS=Bos taurus GN=CTSD PE=1 SV=2 66 436 1.0E-09
sp|P08424|RENI_RAT Renin OS=Rattus norvegicus GN=Ren1 PE=2 SV=2 5 440 2.0E-09
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 66 440 3.0E-09
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 89 456 5.0E-09
sp|Q4WZS3|Y5950_ASPFU Putative aspergillopepsin A-like aspartic endopeptidase AFUA_2G15950 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G15950 PE=3 SV=2 56 194 7.0E-09
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 68 440 8.0E-09
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 68 518 9.0E-09
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 86 440 1.0E-08
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 66 458 1.0E-08
sp|Q9DEX3|CATD_CLUHA Cathepsin D OS=Clupea harengus GN=ctsd PE=1 SV=1 66 436 2.0E-08
sp|Q12567|PEPA_ASPPH Aspartic protease pep1 OS=Aspergillus phoenicis GN=pep1 PE=1 SV=1 16 194 2.0E-08
sp|A2R3L3|PEPA_ASPNC Aspartic protease pep1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pep1 PE=3 SV=1 16 194 4.0E-08
sp|P17946|PEPA_ASPAW Aspartic protease pep1 OS=Aspergillus awamori GN=pep1 PE=1 SV=1 16 194 4.0E-08
sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 46 352 5.0E-08
sp|P00798|PENP_PENJA Penicillopepsin OS=Penicillium janthinellum PE=1 SV=2 71 453 1.0E-07
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 68 518 1.0E-07
sp|P55325|PEPA_ASPNG Aspartic protease pep1 OS=Aspergillus niger GN=pep1 PE=1 SV=1 16 194 2.0E-07
sp|Q6DYE7|RENI_CANLF Renin OS=Canis lupus familiaris GN=REN PE=2 SV=1 50 440 2.0E-07
sp|B6HL60|PEPA_PENRW Aspartic protease pep1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=pep1 PE=3 SV=1 68 187 2.0E-07
sp|Q9HEZ3|PEPB_PENJA Aspartic protease pepB OS=Penicillium janthinellum GN=pepB PE=3 SV=1 71 194 3.0E-07
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 66 436 4.0E-07
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 68 437 6.0E-07
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 87 439 6.0E-07
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 44 352 7.0E-07
sp|C5PEI9|PEPA_COCP7 Aspartic protease PEP3 OS=Coccidioides posadasii (strain C735) GN=PEP3 PE=3 SV=1 69 194 7.0E-07
sp|O93885|PEPA_EMENI Aspartic protease pep1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pep1 PE=3 SV=1 68 194 1.0E-06
sp|Q01972|PEPA_PENRO Aspartic protease pep1 OS=Penicillium roqueforti GN=pep1 PE=2 SV=1 71 371 2.0E-06
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 69 437 2.0E-06
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 71 439 3.0E-06
sp|Q06902|PEPA_ASPOR Aspartic protease pep1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pep1 PE=1 SV=2 71 187 3.0E-06
sp|B8NLY9|PEPA_ASPFN Aspartic protease pep1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pep1 PE=3 SV=1 71 187 3.0E-06
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 68 194 4.0E-06
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 69 244 5.0E-06
sp|A1CBR4|PEPA_ASPCL Aspartic protease pep1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pep1 PE=3 SV=1 71 194 5.0E-06
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 30 440 6.0E-06
sp|D4DE18|Y5382_TRIVH Probable aspartic-type endopeptidase TRV_05382 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_05382 PE=3 SV=1 78 187 7.0E-06
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 56 187 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|105380
MLTSWAQVTLLVASSLSSSVSAFPANPDDTTTQNTKPRGYNLPIHRRIVERSNLGKRGSVTGQTGLGDHTDLLYS
VPIELGDSVVAVNLDTGSSDLWVVSDACTAGTCADSNVRGYSPMSSNANSTGVRVEMFYGDSKTGTYAKGNVGFD
TATVAGIAMTDQAFGIINDTTNVVLKYDTAGIFGLGFPVASKVQEFMVTAEDGPIKTTDNYLLSTYTHGPLLPRI
VITGALPEPIFSITLNRATIDISGVGELAVGKVPDGVDPSSLTWVPVRLYRPSDGGLHAPVFAPNEIYPLRWEID
IDDVYFDGQRLAPSTIPASGDVDTSKISALIDTGNSVIRGPEDVVTNIRRTVSPSYQPSDSNSQVLFPCTSNHTL
AFQIGGKMFPIDPRDFIGQYMDNNATTCIADNVVTTDPPRFGSLYRWSFGDPFFRSNLVVFHYGNLTHPSVDPPR
IGILSRVPPNANDLYQQAVQDAVNNGGNFEETLHIAPTASAAQAPQITVSAESGSISSMISHLTAGATLSLSATQ
MAIPTNNPNNAFHALPRTSILTVITALLSIYILR*
Coding >Agabi119p4|105380
ATGCTCACGTCTTGGGCTCAAGTCACTCTTTTGGTCGCCAGCTCCCTATCAAGTTCTGTTTCCGCTTTCCCCGCA
AATCCTGATGATACAACCACGCAAAACACGAAGCCTCGCGGCTATAACCTTCCTATTCACCGAAGGATTGTCGAG
CGTTCGAATTTGGGAAAACGGGGGAGCGTAACAGGACAGACGGGTTTGGGTGATCATACCGACCTCTTATATTCT
GTACCCATTGAGCTCGGAGATTCTGTCGTAGCTGTTAACCTTGACACTGGCTCCAGCGATTTATGGGTTGTTTCT
GATGCTTGCACTGCGGGAACATGCGCAGATTCAAATGTCCGCGGGTATTCTCCCATGTCCTCAAATGCCAATTCC
ACAGGAGTCAGAGTAGAGATGTTCTATGGAGACTCCAAAACAGGTACATATGCTAAAGGCAACGTTGGATTCGAT
ACCGCCACAGTCGCTGGCATTGCTATGACGGATCAGGCTTTCGGAATCATCAATGACACTACCAACGTTGTGTTG
AAGTACGACACAGCAGGTATATTTGGCTTGGGATTCCCTGTAGCCAGTAAAGTTCAGGAGTTTATGGTGACCGCC
GAGGATGGACCTATCAAAACAACTGACAATTATCTCCTATCAACCTATACTCACGGCCCCCTACTTCCACGAATC
GTCATAACCGGTGCCCTTCCAGAGCCAATATTCTCTATCACTCTGAATAGGGCTACCATCGACATCAGTGGCGTC
GGAGAACTCGCCGTTGGGAAAGTGCCAGATGGTGTTGATCCTTCTTCACTGACATGGGTACCTGTACGGCTTTAC
CGTCCTTCCGATGGCGGATTACACGCACCAGTATTCGCCCCTAACGAAATCTATCCTCTCCGCTGGGAAATTGAT
ATTGATGATGTCTACTTCGACGGCCAACGTCTCGCTCCGTCAACAATACCCGCATCGGGTGATGTTGACACGTCC
AAGATATCGGCTCTCATCGATACAGGAAACTCTGTTATTAGAGGTCCTGAGGACGTAGTGACTAATATCCGACGC
ACAGTCTCGCCTTCCTATCAACCTTCAGACTCAAATTCTCAGGTTCTGTTTCCTTGCACCTCAAATCATACTCTT
GCATTTCAAATCGGGGGAAAGATGTTTCCTATTGACCCGCGCGATTTCATTGGTCAATATATGGACAACAATGCG
ACGACCTGCATAGCGGACAACGTCGTAACGACTGACCCTCCTCGTTTCGGCTCCCTATATCGGTGGAGTTTTGGG
GATCCGTTTTTCCGATCGAACCTCGTCGTATTTCACTACGGTAATCTCACCCATCCTTCAGTTGACCCTCCACGT
ATTGGAATTCTTTCCCGTGTACCTCCCAACGCCAATGATTTGTACCAACAAGCAGTCCAGGATGCGGTTAACAAC
GGCGGAAACTTCGAAGAAACATTGCATATCGCACCCACTGCTAGTGCAGCTCAAGCACCTCAAATCACTGTTTCT
GCTGAGAGCGGGTCAATTAGCTCCATGATCTCGCACCTTACTGCAGGCGCCACGCTCAGTTTATCAGCCACCCAA
ATGGCAATTCCGACGAATAACCCGAATAATGCTTTCCATGCTTTACCAAGGACTTCAATATTGACTGTCATTACG
GCTCTGCTTTCGATATACATACTTCGGTGA
Transcript >Agabi119p4|105380
ATGCTCACGTCTTGGGCTCAAGTCACTCTTTTGGTCGCCAGCTCCCTATCAAGTTCTGTTTCCGCTTTCCCCGCA
AATCCTGATGATACAACCACGCAAAACACGAAGCCTCGCGGCTATAACCTTCCTATTCACCGAAGGATTGTCGAG
CGTTCGAATTTGGGAAAACGGGGGAGCGTAACAGGACAGACGGGTTTGGGTGATCATACCGACCTCTTATATTCT
GTACCCATTGAGCTCGGAGATTCTGTCGTAGCTGTTAACCTTGACACTGGCTCCAGCGATTTATGGGTTGTTTCT
GATGCTTGCACTGCGGGAACATGCGCAGATTCAAATGTCCGCGGGTATTCTCCCATGTCCTCAAATGCCAATTCC
ACAGGAGTCAGAGTAGAGATGTTCTATGGAGACTCCAAAACAGGTACATATGCTAAAGGCAACGTTGGATTCGAT
ACCGCCACAGTCGCTGGCATTGCTATGACGGATCAGGCTTTCGGAATCATCAATGACACTACCAACGTTGTGTTG
AAGTACGACACAGCAGGTATATTTGGCTTGGGATTCCCTGTAGCCAGTAAAGTTCAGGAGTTTATGGTGACCGCC
GAGGATGGACCTATCAAAACAACTGACAATTATCTCCTATCAACCTATACTCACGGCCCCCTACTTCCACGAATC
GTCATAACCGGTGCCCTTCCAGAGCCAATATTCTCTATCACTCTGAATAGGGCTACCATCGACATCAGTGGCGTC
GGAGAACTCGCCGTTGGGAAAGTGCCAGATGGTGTTGATCCTTCTTCACTGACATGGGTACCTGTACGGCTTTAC
CGTCCTTCCGATGGCGGATTACACGCACCAGTATTCGCCCCTAACGAAATCTATCCTCTCCGCTGGGAAATTGAT
ATTGATGATGTCTACTTCGACGGCCAACGTCTCGCTCCGTCAACAATACCCGCATCGGGTGATGTTGACACGTCC
AAGATATCGGCTCTCATCGATACAGGAAACTCTGTTATTAGAGGTCCTGAGGACGTAGTGACTAATATCCGACGC
ACAGTCTCGCCTTCCTATCAACCTTCAGACTCAAATTCTCAGGTTCTGTTTCCTTGCACCTCAAATCATACTCTT
GCATTTCAAATCGGGGGAAAGATGTTTCCTATTGACCCGCGCGATTTCATTGGTCAATATATGGACAACAATGCG
ACGACCTGCATAGCGGACAACGTCGTAACGACTGACCCTCCTCGTTTCGGCTCCCTATATCGGTGGAGTTTTGGG
GATCCGTTTTTCCGATCGAACCTCGTCGTATTTCACTACGGTAATCTCACCCATCCTTCAGTTGACCCTCCACGT
ATTGGAATTCTTTCCCGTGTACCTCCCAACGCCAATGATTTGTACCAACAAGCAGTCCAGGATGCGGTTAACAAC
GGCGGAAACTTCGAAGAAACATTGCATATCGCACCCACTGCTAGTGCAGCTCAAGCACCTCAAATCACTGTTTCT
GCTGAGAGCGGGTCAATTAGCTCCATGATCTCGCACCTTACTGCAGGCGCCACGCTCAGTTTATCAGCCACCCAA
ATGGCAATTCCGACGAATAACCCGAATAATGCTTTCCATGCTTTACCAAGGACTTCAATATTGACTGTCATTACG
GCTCTGCTTTCGATATACATACTTCGGTGA
Gene >Agabi119p4|105380
ATGCTCACGTCTTGGGCTCAAGTCACTCTTTTGGTCGCCAGCTCCCTATCAAGTTCTGTTTCCGCTTTCCCCGCA
AATCCTGATGATACAACCACGCAAAACACGAAGCCTCGCGGCTATAACCTTCCTATTCACCGAAGGATTGTCGAG
CGTTCGAATTTGGGAAAACGGGGGAGCGTAACAGGACAGACGGGTTTGGGTGATCATACCGACCTGTGAGTAGTA
GCAGCCATTCTTTGAGAGGACAATTAAGTTAATTCAAATCTAGCTTATATTCTGTACCCATTGAGCTCGGAGATT
CTGTCGTAGCTGTTAACCTTGGTTAGCGTTCTGCCCACATCTCTTCACTCCGTTTATTCATCTGGTCTCCCAGAC
ACTGGCTCCAGCGATTTATGGGTTGTTTCTGATGCTTGCACTGCGGGAACATGCGCAGATTCAAATGTCCGCGGG
TATTCTCCCATGTCCTCAAATGCCAATTCCACAGGAGTCAGAGTAGAGATGTTCTATGGAGACTCCAAAACAGGT
ACATATGCTAAAGGCAACGTTGGATTCGATACCGCCACAGTCGCTGGCATTGCTATGACGGATCAGGCTTTCGGA
ATCATCAATGACACTACCAACGTTGTGTTGAAGTACGACACAGCAGGTATATTTGGCTTGGGATTCCCTGTAGCC
AGGTGGGTGATATTTGCCGTCTCCATCATCTATTCGTCGATTGTTGATTCCATCACCTATCTGCCAGTAAAGTTC
AGGAGTTTATGGTGACCGCCGAGGTATATCTTCAACGTTGCACGTCCTATGTCAGTGTATGAGTAATTGTAAACC
AGGATGGACCTATCAAAACAACTGACAATTATCTCCTATCAACCTATACTCACGGCCCCCTACTTCCACGAATCG
TCATAACCGGTGCCCTTCCAGAGCCAATATTCTCTGTTCGTATCGATCAGGTAGCCTCTTGGTCACTATAAACTG
ATGTTCCGCCAGATCACTCTGAATAGGGCTACCATCGACATCAGTGGCGTCGGAGAACTCGCCGTTGGGAAAGTG
CCAGATGGTGTTGATCCTTCTTCACTGACATGGGTACCTGTACGGCTTTACCGTCCTTCCGATGGCGGATTACAC
GCACCAGTATTCGCCCCTAACGAAATCTATCCTCTGTATGTTTGTCGAGGCTGTTTAACAACTGTGGTTTCTGAT
CCTAATCGTTTAGCCGCTGGGAAATTGATATTGATGATGTCTACTTCGACGGCCAACGTCTCGCTCCGTCAACAA
TACCCGCATCGGGTGATGTTGACACGTCCAAGATATCGGCTCTCATCGATACAGTTCGTGTCATATTCGATGTAA
CACCCCTCCCAGTTAATTTATTCTCATTTCCAGGGAAACTCTGTTATTAGAGGTCCTGAGGACGTAGTGACTAAT
ATCCGACGCACAGTCTCGCCTTCCTATCAACCTTCAGACTCAAATTCTCAGGTTCTGTTTCCTTGCACCTCAAAT
CATACTCTTGCATTTCAAATCGGGGGAAAGGTATTGCTACGCATTACTCAGTGGGCGTGCGTGAACTAACGTGAC
TTTTACTTTTCTGTAGATGTTTCCTATTGACCCGCGCGATTTCATTGGTCAATATATGGACAACAATGCGACGAC
CTGCATAGCGGACAACGTCGTAACGACTGACCCTCCTCGTTTCGGCTCCCTATATCGGTGGAGTTTTGGGGATCC
GTTTTTCCGATCGTACGTGTCACGATGACCAAATTTGCATCTCAAAATCTTAAACTCTGAAATCAGGAACCTCGT
CGTATTTCACTACGGTAATCTCACCCATCCTTCAGTTGACCCTCCACGTATTGGAATTCTTTCCCGTGTACCTCC
CAACGCCAATGATTTGTACCAACAAGCAGTCCAGGATGCGGTTAACAACGGCGGAAACTTCGAAGGTATGTACTT
ATGAACCTTCGCTTGTAATTGCGCTCTCATTTTTGTTATTTCCAGAAACATTGCATATCGCACCCACTGCTAGTG
CAGCTCAAGCACCTCAAATCACTGTTTCTGCTGAGAGCGGGTCAATTAGCTCCATGATCTCGCACCTTACTGCAG
GCGCCACGCTCAGTTTATCAGCCACCCAAATGGCAATTCCGACGAATAACCCGAATAATGCTTTCCATGCTTTAC
CAAGGACTTCAATATTGACTGTCATTACGGCTCTGCTTTCGATATACATACTTCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail