Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|105370
Gene name
Locationscaffold_07:1998055..2000540
Strand+
Gene length (bp)2485
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 4.1E-19 127 270
PF08031 BBE Berberine and berberine like 5.7E-09 515 551

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 36 559 1.0E-66
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 36 559 4.0E-64
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 122 552 2.0E-08
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 127 552 2.0E-08
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 122 321 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 36 559 1.0E-66
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 36 559 4.0E-64
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 122 552 2.0E-08
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 127 552 2.0E-08
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 122 321 3.0E-08
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 96 321 5.0E-08
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 134 323 6.0E-07
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 127 320 6.0E-07
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 138 300 2.0E-06
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 127 304 2.0E-06
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 101 321 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|105370
MLSLTARILILGLLAQYNGQVKAQKSKGSTVTSEDWENLNQTVAGRLFQGNPFAEPCFSGQFDSPECKAIQDGYL
DEKTRTDNPGAYIETQWSTCQATGEQCLLDSLNPHDPLPTLPPQECKRGSVPDYFINVQEANDVKEAFAFAKEHD
IPLVVKNTGHDYKGRSSAPGSLGLWTYNLKDMKYTPDFVPTGCSTKPQQGFTAGAGVQWGEAYAFADSNNITVVG
GSDQTVGVTGGWLQGGGHGALSPSLGLGVDRVLEIKVVTPDGELKIANECQNEDLFWALRGGGGGTFGVVLDHTI
LASPRVTLPTLILSFAPDTTLAREMWSIMADNALKWAEEGWGGFSRSNVMILLNPKLSQTEAQASLAPLLDFGKQ
LQATNPDTTTLIFTEFSSWNEFFQTFTSQFVAVVGANLALASRLIPKDLFQTADTKEDFVSALLAADAATPGLII
LIAAPTAFPFVPGSTSVTEAWRSSLYHITLRSNWNWNATLAEKKSHYDAASQSIDNLRKITPDAAYQNEADVHEP
NHEVSFWGDNYSRLLQIKEKYDPDHLLDCWHCVGWRQESPRFSCYI*
Coding >Agabi119p4|105370
ATGCTCTCGCTTACTGCAAGAATCCTCATTCTGGGCTTACTAGCCCAATACAATGGCCAAGTCAAAGCTCAAAAG
TCGAAGGGATCCACTGTGACGTCCGAAGACTGGGAAAATCTAAACCAGACCGTTGCTGGCCGTTTATTCCAAGGC
AATCCTTTCGCTGAACCATGCTTTTCTGGTCAATTCGATTCACCGGAGTGTAAGGCTATACAAGATGGTTATTTG
GATGAAAAGACGAGAACAGACAATCCTGGCGCGTACATAGAGACTCAATGGAGTACCTGTCAGGCAACGGGAGAA
CAATGCCTCTTGGATTCCCTGAATCCACACGATCCACTGCCTACGTTACCGCCACAGGAGTGCAAACGTGGGAGC
GTTCCAGATTATTTCATCAATGTTCAGGAGGCGAACGATGTCAAGGAGGCATTTGCATTCGCGAAGGAACACGAT
ATTCCGCTTGTGGTCAAGAATACGGGCCATGACTATAAGGGAAGAAGTAGTGCTCCGGGTTCACTAGGACTTTGG
ACTTACAATCTCAAGGACATGAAATATACTCCAGACTTTGTTCCCACTGGCTGCAGCACAAAGCCACAGCAAGGA
TTTACAGCTGGGGCTGGTGTACAATGGGGCGAGGCATATGCATTTGCTGATTCAAATAATATAACGGTCGTAGGT
GGAAGCGACCAGACTGTCGGCGTGACAGGTGGGTGGCTACAGGGCGGTGGCCATGGCGCTCTATCGCCAAGTTTG
GGTCTTGGTGTTGATCGTGTCCTGGAGATCAAAGTTGTGACCCCAGATGGTGAACTGAAGATAGCGAACGAGTGT
CAGAATGAAGATCTATTTTGGGCCCTTCGAGGAGGCGGTGGTGGAACGTTTGGTGTCGTGCTAGATCACACAATC
CTTGCATCGCCTCGGGTCACTCTGCCGACCTTGATCTTGTCTTTCGCTCCTGATACGACGTTAGCTCGTGAGATG
TGGTCCATCATGGCTGATAACGCCTTAAAGTGGGCCGAGGAAGGGTGGGGAGGCTTTTCCAGGTCAAATGTTATG
ATTCTCTTGAACCCAAAGCTATCGCAAACGGAAGCTCAAGCTTCCCTCGCTCCACTACTCGACTTTGGGAAGCAA
CTGCAGGCAACAAACCCAGATACCACAACTCTGATTTTCACTGAATTCTCCTCTTGGAACGAATTTTTCCAAACT
TTTACAAGCCAATTTGTTGCGGTTGTCGGTGCCAATTTAGCCCTTGCTTCCCGGCTTATTCCCAAAGACCTTTTC
CAAACTGCCGACACGAAAGAAGATTTTGTTTCGGCGCTTTTAGCAGCAGACGCAGCCACACCAGGACTTATCATC
CTAATAGCCGCCCCTACAGCCTTCCCATTCGTCCCTGGCTCAACTAGTGTCACTGAAGCTTGGAGGTCAAGTTTG
TATCATATCACACTACGTTCGAACTGGAATTGGAATGCTACCTTGGCTGAGAAGAAGTCGCATTACGACGCTGCA
AGTCAGTCGATTGATAATTTGAGAAAGATTACACCGGACGCGGCTTATCAGAATGAGGCTGATGTGCATGAGCCG
AATCATGAAGTTAGTTTCTGGGGTGATAACTACTCGAGACTCTTACAAATCAAGGAGAAATACGATCCTGATCAT
CTTCTTGATTGCTGGCATTGTGTTGGATGGCGTCAAGAGTCTCCCCGTTTCTCTTGTTACATTTGA
Transcript >Agabi119p4|105370
ATGCTCTCGCTTACTGCAAGAATCCTCATTCTGGGCTTACTAGCCCAATACAATGGCCAAGTCAAAGCTCAAAAG
TCGAAGGGATCCACTGTGACGTCCGAAGACTGGGAAAATCTAAACCAGACCGTTGCTGGCCGTTTATTCCAAGGC
AATCCTTTCGCTGAACCATGCTTTTCTGGTCAATTCGATTCACCGGAGTGTAAGGCTATACAAGATGGTTATTTG
GATGAAAAGACGAGAACAGACAATCCTGGCGCGTACATAGAGACTCAATGGAGTACCTGTCAGGCAACGGGAGAA
CAATGCCTCTTGGATTCCCTGAATCCACACGATCCACTGCCTACGTTACCGCCACAGGAGTGCAAACGTGGGAGC
GTTCCAGATTATTTCATCAATGTTCAGGAGGCGAACGATGTCAAGGAGGCATTTGCATTCGCGAAGGAACACGAT
ATTCCGCTTGTGGTCAAGAATACGGGCCATGACTATAAGGGAAGAAGTAGTGCTCCGGGTTCACTAGGACTTTGG
ACTTACAATCTCAAGGACATGAAATATACTCCAGACTTTGTTCCCACTGGCTGCAGCACAAAGCCACAGCAAGGA
TTTACAGCTGGGGCTGGTGTACAATGGGGCGAGGCATATGCATTTGCTGATTCAAATAATATAACGGTCGTAGGT
GGAAGCGACCAGACTGTCGGCGTGACAGGTGGGTGGCTACAGGGCGGTGGCCATGGCGCTCTATCGCCAAGTTTG
GGTCTTGGTGTTGATCGTGTCCTGGAGATCAAAGTTGTGACCCCAGATGGTGAACTGAAGATAGCGAACGAGTGT
CAGAATGAAGATCTATTTTGGGCCCTTCGAGGAGGCGGTGGTGGAACGTTTGGTGTCGTGCTAGATCACACAATC
CTTGCATCGCCTCGGGTCACTCTGCCGACCTTGATCTTGTCTTTCGCTCCTGATACGACGTTAGCTCGTGAGATG
TGGTCCATCATGGCTGATAACGCCTTAAAGTGGGCCGAGGAAGGGTGGGGAGGCTTTTCCAGGTCAAATGTTATG
ATTCTCTTGAACCCAAAGCTATCGCAAACGGAAGCTCAAGCTTCCCTCGCTCCACTACTCGACTTTGGGAAGCAA
CTGCAGGCAACAAACCCAGATACCACAACTCTGATTTTCACTGAATTCTCCTCTTGGAACGAATTTTTCCAAACT
TTTACAAGCCAATTTGTTGCGGTTGTCGGTGCCAATTTAGCCCTTGCTTCCCGGCTTATTCCCAAAGACCTTTTC
CAAACTGCCGACACGAAAGAAGATTTTGTTTCGGCGCTTTTAGCAGCAGACGCAGCCACACCAGGACTTATCATC
CTAATAGCCGCCCCTACAGCCTTCCCATTCGTCCCTGGCTCAACTAGTGTCACTGAAGCTTGGAGGTCAAGTTTG
TATCATATCACACTACGTTCGAACTGGAATTGGAATGCTACCTTGGCTGAGAAGAAGTCGCATTACGACGCTGCA
AGTCAGTCGATTGATAATTTGAGAAAGATTACACCGGACGCGGCTTATCAGAATGAGGCTGATGTGCATGAGCCG
AATCATGAAGTTAGTTTCTGGGGTGATAACTACTCGAGACTCTTACAAATCAAGGAGAAATACGATCCTGATCAT
CTTCTTGATTGCTGGCATTGTGTTGGATGGCGTCAAGAGTCTCCCCGTTTCTCTTGTTACATTTGA
Gene >Agabi119p4|105370
ATGCTCTCGCTTACTGCAAGAATCCTCATTCTGGGCTTACTAGCCCAATACAATGGCCAAGTCAAAGCTCAAAAG
TCGAAGGGATCCACTGTGACGTCCGAAGACTGGGAAAATCTAAACCAGACCGTTGCTGGCCGTTTATTCCAAGGC
AATCCTTTCGCTGAACCATGCTTTTCTGGTCAATTCGATTCACCGGAGTGTAAGGCTATACAAGATGGTTATTTG
GATGAAAGTGAGTTCTTGTTTGTATTCAACTGTGATCACTGGTTTTGATAGGTATGACTTCGTTGCGTGTTTCAG
AGACGAGAACAGACAATCCTGGCGCGTACATAGAGACTCAATGGAGTACCTGTCAGGCAACGGGAGAACAATGCC
TCTTGGATTCCCTGAATCCACACGATCCACTGCCTACGTTACCGCCACAGGAGTGCAAACGTGGGAGCGTTCCAG
ATTATTTCGTACGTCCTCATGTTCTCGGCTATACGCTTGTATTGATCAGAATATTAGATCAATGTTCAGGAGGCG
AACGATGTCAAGGAGGCATTTGCATTCGCGAAGGAACACGATATTCCGCTTGTGGTCAAGAATACGGGCGTGAGT
GGCGTTTGACCAATGGTCGACAGTGGGTCTGAAAAAGACGAAACAGCATGACTATAAGGGAAGAAGTAGTGCTCC
GGGTTCACTAGGACTTTGGGTAAGCGAATAACGTTGATATATCACGGATCTGAAACTTATCCGACTCGTTCCAGA
CTTACAATCTCAAGGACGTATGTTCAGGCCACTCTACGTTTCATTGAAATTATCTCACTGCACTCCAGATGAAAT
ATACTCCAGACTTTGTTCCCACTGGCTGCAGCACAAAGCCACAGCAAGGATTTACAGCTGGGGTACGGCTATTCA
TAGGTCAAACTTTGTGTGATCAGGCGATTCTAACTTTGTTATAGGCTGGTGTACAATGGGGCGAGGCATATGCAT
TTGCTGATTCAAATAATATAACGGTCGTAGGTGGTAGGTGGGGATGAGCTTTAATTTAACGTGTTATTAATACCC
CGCACCAGGAAGCGACCAGACTGTCGGCGTGACAGGTGGGTGGCTACAGGGCGGTGGCCATGGCGCTCTATCGCC
AAGTTTGGGTCTTGGTGTTGATCGTGTCGTGAGTGTGATTTCGTTTTAAAAGAAAATATAAAACTCAATCTGTTT
TAGCTGGAGATCAAAGTTGTGACCCCAGATGGTGAACTGAAGATAGCGAACGAGTGTCAGAATGAAGATCTATTT
TGGGCCCTTCGAGGAGGTGAGCACCCTAGTAACCTTGATGAAAGATTGATCTCTCAGATTTCGCAGGCGGTGGTG
GAACGTTTGGTGTCGTGCTAGATCACACAATCCTTGCATCGCCTCGGGTCACTCTGCCGACCTTGATCTTGTCTT
TCGCTCCTGATACGACGTTAGCTCGTGAGATGTGGTCCATCATGGCTGATAACGCCTTAAAGTGGGCCGAGGAAG
GGTGGGGAGGCTTTTCCAGGTCAAATGTTATGATTCTCTTGAACCCAAAGCTATCGCAAACGGAAGCTCAAGCTT
CCCTCGCTCCACTACTCGACTTTGGGAAGCAACTGCAGGCAACAAACCCAGATACCACAACTCTGATTTTCACTG
AATTCTCCTCTTGGAACGAATTTTTCCAAACTTTTACAAGCCAATTTGTTGCGGTGAGATCTCTCCCTCGATATG
GACACCCTGAATCGCGGGCTAAATGATGTTGTAGGTTGTCGGTGCCAATTTAGCCCTTGCTTCCCGGCTTATTCC
CAAAGACCTTTTCCAAACTGCCGACACGAAAGAAGATTTTGTTTCGGCGCTTTTAGCAGCAGACGCAGCCACACC
AGGACTTATCATCCTAATAGCCGCCCCTACAGCCTTCCCATTCGTCCCTGGCTCAACTAGTGTCACTGAAGCTTG
GAGGTCAAGTTTGTATCATATCACACTACGTTCGAACTGGAATTGGAATGCTACCTTGGCTGAGAAGAAGTCGCA
TTACGACGCTGCAAGTCAGTCGATTGATAATTTGAGAAAGATTACACCGGACGCGGCTTATCAGGTCAGATTTTG
AGGCATATCTTTGTTGTTATGCAAAATTGACACGGGTATTTCAGAATGAGGCTGATGTGCATGAGCCGAATCATG
AAGGTACGATCAAAAAAATGAATCTTTCATCGTGTTACTGTTCTTACTGAAACGATTGCTTTTTATAGTTAGTTT
CTGGGGTGATAACTACTCGAGACTCTTACAAATCAAGGAGAAATAGTACGCCTTTTGTCTCCTTCTAGGTGGAAA
TCACACACTGATGTTACTTGACACAGCGATCCTGATCATCTTCTTGATTGCTGGCATTGTGGTAAGTGCTATTAA
ATTATGGGTGTGCGGCGCACCTAACATCCTGCCTCGTCCAGTTGGATGGCGTCAAGAGTCTCCCCGTTTCTCTTG
TTACATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail