Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|105090
Gene name
Locationscaffold_07:1923051..1925819
Strand+
Gene length (bp)2768
Transcript length (bp)2271
Coding sequence length (bp)2271
Protein length (aa) 757

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 8.4E-21 354 555
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.1E-06 95 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 35 86 4.0E-09
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 35 85 5.0E-09
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 21 132 4.0E-08
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 357 676 6.0E-08
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 31 103 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 35 86 4.0E-09
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 35 85 5.0E-09
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 21 132 4.0E-08
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 357 676 6.0E-08
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 31 103 6.0E-08
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 11 82 7.0E-08
sp|Q8VIG1|REST_MOUSE RE1-silencing transcription factor OS=Mus musculus GN=Rest PE=1 SV=2 11 111 1.0E-07
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 29 95 2.0E-07
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 24 79 2.0E-07
sp|Q05620|CREA_ASPNG DNA-binding protein creA OS=Aspergillus niger GN=creA PE=3 SV=1 29 98 2.0E-07
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 6 82 2.0E-07
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 6 82 3.0E-07
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 6 82 3.0E-07
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 29 93 3.0E-07
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 24 98 3.0E-07
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 6 82 3.0E-07
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 6 82 3.0E-07
sp|O94131|CREA_GIBFU DNA-binding protein creA OS=Gibberella fujikuroi GN=CREA PE=3 SV=1 10 91 3.0E-07
sp|O54963|REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus GN=Rest PE=1 SV=1 13 111 3.0E-07
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 6 82 4.0E-07
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 35 82 4.0E-07
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 6 82 5.0E-07
sp|Q13127|REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 11 111 5.0E-07
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 31 83 6.0E-07
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 6 82 7.0E-07
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 6 82 7.0E-07
sp|A2QCJ9|CREA_ASPNC Probable DNA-binding protein creA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creA PE=3 SV=1 29 132 8.0E-07
sp|O94166|CREA_ASPAC DNA-binding protein creA OS=Aspergillus aculeatus GN=creA PE=3 SV=1 29 93 8.0E-07
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 6 82 8.0E-07
sp|Q8VCZ7|ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus GN=Zbtb7c PE=2 SV=1 4 81 9.0E-07
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 6 82 9.0E-07
sp|Q9P889|CREA_ASPOR DNA-binding protein creA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creA PE=3 SV=1 29 92 9.0E-07
sp|B8NGC8|CREA_ASPFN Probable DNA-binding protein creA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creA PE=3 SV=1 29 92 9.0E-07
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 35 83 1.0E-06
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 18 100 1.0E-06
sp|Q5RJ54|ZSC26_MOUSE Zinc finger and SCAN domain-containing protein 26 OS=Mus musculus GN=Zscan26 PE=2 SV=1 14 103 1.0E-06
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 3 81 1.0E-06
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 29 81 1.0E-06
sp|P50898|MIG1_KLULA Regulatory protein MIG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIG1 PE=3 SV=1 30 81 1.0E-06
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 19 98 2.0E-06
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 27 81 2.0E-06
sp|Q8CFA7|KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus GN=Klf17 PE=1 SV=2 16 82 2.0E-06
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 29 81 2.0E-06
sp|P52288|MIG1_KLUMA Regulatory protein MIG1 OS=Kluyveromyces marxianus GN=MIG1 PE=3 SV=1 34 81 2.0E-06
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 35 83 2.0E-06
sp|A1DH89|CREA_NEOFI Probable DNA-binding protein creA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creA PE=3 SV=1 29 81 2.0E-06
sp|Q92766|RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens GN=RREB1 PE=1 SV=3 31 96 2.0E-06
sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens GN=ZBTB7C PE=2 SV=1 4 103 2.0E-06
sp|A1C6L9|CREA_ASPCL Probable DNA-binding protein creA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creA PE=3 SV=1 29 98 2.0E-06
sp|B0XSK6|CREA_ASPFC Probable DNA-binding protein creA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creA PE=3 SV=1 29 81 2.0E-06
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 35 168 2.0E-06
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 19 95 3.0E-06
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 17 82 3.0E-06
sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG1 PE=1 SV=1 30 97 3.0E-06
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 19 98 3.0E-06
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 20 81 4.0E-06
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 19 95 4.0E-06
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 17 82 4.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 16 82 4.0E-06
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 19 95 4.0E-06
sp|Q3UH06|RREB1_MOUSE Ras-responsive element-binding protein 1 OS=Mus musculus GN=Rreb1 PE=1 SV=2 33 96 4.0E-06
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 15 105 5.0E-06
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 17 82 5.0E-06
sp|O57415|RREB1_CHICK Ras-responsive element-binding protein 1 OS=Gallus gallus GN=RREB1 PE=2 SV=2 5 96 5.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 16 82 5.0E-06
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 17 82 6.0E-06
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 16 82 6.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 19 103 6.0E-06
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 27 82 7.0E-06
sp|Q9HBE1|PATZ1_HUMAN POZ-, AT hook-, and zinc finger-containing protein 1 OS=Homo sapiens GN=PATZ1 PE=1 SV=1 19 109 7.0E-06
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 35 93 7.0E-06
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 35 93 8.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 16 80 8.0E-06
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 35 93 8.0E-06
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 35 93 8.0E-06
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 18 87 8.0E-06
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 35 93 8.0E-06
sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens GN=ZBTB7C PE=2 SV=1 19 94 9.0E-06
sp|Q5A0E5|NRG1_CANAL Transcriptional regulator NRG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NRG1 PE=2 SV=1 34 99 9.0E-06
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 15 82 9.0E-06
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 15 81 9.0E-06
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 15 81 9.0E-06
sp|Q8VCZ7|ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus GN=Zbtb7c PE=2 SV=1 19 94 9.0E-06
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 15 81 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0065007 biological regulation No
GO:0019222 regulation of metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0044238 primary metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046872 metal ion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0031323 regulation of cellular metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0003674 molecular_function No
GO:0018130 heterocycle biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0019438 aromatic compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0050794 regulation of cellular process No
GO:0016070 RNA metabolic process No
GO:0009987 cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0009058 biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0043169 cation binding No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|105090
MPAVRHSIDLKANGEVSRMRHHKGNMPSLPQTKFCSLCPAKFTRTTHLNRHLRSHTNERLHRCNTCNAEFTRSDL
LTRHKRTCGDSRNANRSRRKSCQACAESKVKCNLQYPCSKCSSRGRECVFINDPEASRNKRNAAKRAMQQAAAAK
AAGDPTMSETPSSMSSKSSPPYTSLLMHTPSPTLSLDSQLLSLAPFELPGLSTSSSSSIASSGSSPRSDLLEPRG
DFAPSFQVSAFDTLSLDNQLNRLFPNSTSCFDNFGIQSSFSPPSGPFQELSTWLDGGEQLQKYGDNDMISYAHAS
HEIKVEGQDNLQEYGPPGLPFSLNTIINPTGGLSDPSALSSAPEPTPEELEHYLYLFFSAFGTQIPLVHPSTWKP
EGKPPVLIRAMQACGALFVKTKTATNFVNDTLAETRDVLIAEFTNSGSDLSQQVNIIIAVVLLQTIALYYQRPEQ
RSFSNTYHAILVTMIRRIRLIDRVSAWSPPDLTDVSGLDKAWKAWAQYETIKRALFVSYLHDCCHCLYFSLPPSF
QPSELDINLPCDDGIWAAGSAAQWLQAIKSPSQYGVGMARLSGFSMQRALATLSGAQSPATLPALNPFAHFILIH
TIIRDLYVSSARDRPDGSPTDTTRDSGITTSTQRALQTWTQMWVNSPDATRYDNNREEAPFVYNALPFFWLAQVS
LMVLQEDSGVDTKLIEPQNEAGFRFLKEWLARLRYHLRNGTQIPPQLWDELMKIRTQLQLQQADRSNCEQACGLV
DIYQKS*
Coding >Agabi119p4|105090
ATGCCCGCTGTAAGGCATTCGATAGACCTTAAAGCTAACGGAGAGGTTAGCCGTATGCGCCACCATAAAGGTAAC
ATGCCCTCCCTGCCACAGACAAAATTTTGTTCTCTATGTCCTGCCAAATTCACTCGCACCACACATCTCAATCGC
CACCTACGTTCACATACAAACGAACGGTTGCATCGATGTAACACATGTAATGCAGAATTCACACGGAGCGATTTG
CTTACACGACATAAGCGAACATGCGGCGACTCCCGAAATGCTAACCGGTCGCGGCGCAAGTCCTGTCAGGCGTGC
GCAGAATCGAAGGTCAAATGCAATTTGCAATATCCCTGCTCCAAGTGCTCGTCGAGAGGAAGAGAATGCGTATTC
ATTAACGATCCGGAGGCGTCAAGGAACAAACGTAATGCAGCAAAGAGAGCAATGCAGCAAGCTGCTGCCGCCAAA
GCTGCAGGTGATCCTACAATGTCGGAAACACCTTCGTCAATGTCATCGAAATCTTCACCTCCGTACACCTCGCTT
TTGATGCATACCCCGTCGCCGACACTTTCGTTGGATAGTCAGCTATTATCCCTCGCTCCCTTCGAACTTCCGGGC
CTCTCGACCTCCTCGAGCTCTTCCATTGCCTCAAGCGGGTCATCTCCTCGGTCAGATCTCCTTGAACCTCGCGGA
GACTTTGCGCCATCCTTCCAGGTTTCGGCTTTTGATACTTTAAGCTTGGATAACCAGCTGAACAGACTTTTCCCC
AACTCTACGTCGTGCTTTGACAATTTCGGCATACAATCATCATTCTCTCCACCTTCTGGACCGTTCCAAGAACTA
TCGACATGGCTGGATGGCGGTGAACAGCTACAGAAGTATGGAGATAACGATATGATCTCTTATGCCCATGCATCC
CATGAAATCAAGGTAGAGGGCCAGGATAACCTTCAAGAATATGGCCCACCGGGACTGCCTTTTTCCTTAAACACT
ATCATCAACCCAACAGGAGGTCTCTCCGATCCCTCGGCTCTCTCCAGTGCTCCCGAACCCACGCCCGAGGAGTTA
GAACACTATCTATACCTCTTTTTCTCTGCGTTTGGCACTCAAATACCTCTTGTCCACCCTTCTACGTGGAAGCCG
GAAGGCAAACCTCCGGTCCTCATTCGTGCCATGCAAGCATGCGGAGCGCTATTTGTCAAAACGAAGACAGCAACA
AATTTTGTCAATGATACTCTAGCAGAAACGCGGGATGTTCTAATCGCGGAATTCACCAACTCTGGCTCAGATTTG
AGTCAGCAAGTGAACATTATCATCGCTGTCGTCCTTTTGCAAACAATCGCTCTTTACTACCAGCGACCAGAACAA
AGGTCGTTTTCTAACACTTATCACGCGATCCTTGTTACGATGATTCGCCGTATCAGGCTCATTGATCGGGTCTCG
GCATGGAGCCCTCCAGACCTTACTGATGTTAGTGGACTGGACAAAGCATGGAAAGCCTGGGCGCAGTATGAAACA
ATCAAACGGGCGCTTTTCGTTTCGTACCTGCACGATTGCTGTCACTGCTTATATTTCTCCTTGCCGCCGTCGTTT
CAGCCTAGCGAATTGGATATCAATCTGCCATGTGATGACGGGATATGGGCAGCGGGTAGTGCAGCACAGTGGCTA
CAAGCTATCAAGTCGCCCTCTCAATATGGAGTTGGAATGGCAAGGCTCTCTGGTTTCAGCATGCAACGTGCATTA
GCGACATTAAGCGGAGCGCAGTCACCGGCAACTCTCCCTGCACTCAATCCCTTCGCCCATTTCATCCTCATTCAC
ACCATTATTCGGGACCTATATGTCTCGAGTGCTCGAGATCGTCCCGATGGCTCACCTACGGACACGACGAGAGAC
AGCGGGATAACTACCTCTACACAACGTGCTCTCCAAACCTGGACTCAGATGTGGGTCAATAGTCCCGATGCGACG
CGCTACGATAACAACCGGGAGGAAGCACCTTTTGTCTACAATGCCCTCCCTTTCTTTTGGCTGGCTCAAGTGTCA
CTGATGGTCCTTCAGGAGGATTCTGGTGTTGACACTAAACTGATCGAACCTCAGAATGAGGCCGGATTTCGTTTC
TTGAAGGAATGGCTTGCGAGACTCCGGTACCATCTCCGAAACGGAACACAGATCCCTCCTCAGCTTTGGGATGAG
TTGATGAAAATTCGTACGCAACTTCAACTGCAGCAGGCAGACCGGAGTAATTGTGAGCAAGCCTGCGGCTTGGTC
GACATCTATCAGAAGAGTTAA
Transcript >Agabi119p4|105090
ATGCCCGCTGTAAGGCATTCGATAGACCTTAAAGCTAACGGAGAGGTTAGCCGTATGCGCCACCATAAAGGTAAC
ATGCCCTCCCTGCCACAGACAAAATTTTGTTCTCTATGTCCTGCCAAATTCACTCGCACCACACATCTCAATCGC
CACCTACGTTCACATACAAACGAACGGTTGCATCGATGTAACACATGTAATGCAGAATTCACACGGAGCGATTTG
CTTACACGACATAAGCGAACATGCGGCGACTCCCGAAATGCTAACCGGTCGCGGCGCAAGTCCTGTCAGGCGTGC
GCAGAATCGAAGGTCAAATGCAATTTGCAATATCCCTGCTCCAAGTGCTCGTCGAGAGGAAGAGAATGCGTATTC
ATTAACGATCCGGAGGCGTCAAGGAACAAACGTAATGCAGCAAAGAGAGCAATGCAGCAAGCTGCTGCCGCCAAA
GCTGCAGGTGATCCTACAATGTCGGAAACACCTTCGTCAATGTCATCGAAATCTTCACCTCCGTACACCTCGCTT
TTGATGCATACCCCGTCGCCGACACTTTCGTTGGATAGTCAGCTATTATCCCTCGCTCCCTTCGAACTTCCGGGC
CTCTCGACCTCCTCGAGCTCTTCCATTGCCTCAAGCGGGTCATCTCCTCGGTCAGATCTCCTTGAACCTCGCGGA
GACTTTGCGCCATCCTTCCAGGTTTCGGCTTTTGATACTTTAAGCTTGGATAACCAGCTGAACAGACTTTTCCCC
AACTCTACGTCGTGCTTTGACAATTTCGGCATACAATCATCATTCTCTCCACCTTCTGGACCGTTCCAAGAACTA
TCGACATGGCTGGATGGCGGTGAACAGCTACAGAAGTATGGAGATAACGATATGATCTCTTATGCCCATGCATCC
CATGAAATCAAGGTAGAGGGCCAGGATAACCTTCAAGAATATGGCCCACCGGGACTGCCTTTTTCCTTAAACACT
ATCATCAACCCAACAGGAGGTCTCTCCGATCCCTCGGCTCTCTCCAGTGCTCCCGAACCCACGCCCGAGGAGTTA
GAACACTATCTATACCTCTTTTTCTCTGCGTTTGGCACTCAAATACCTCTTGTCCACCCTTCTACGTGGAAGCCG
GAAGGCAAACCTCCGGTCCTCATTCGTGCCATGCAAGCATGCGGAGCGCTATTTGTCAAAACGAAGACAGCAACA
AATTTTGTCAATGATACTCTAGCAGAAACGCGGGATGTTCTAATCGCGGAATTCACCAACTCTGGCTCAGATTTG
AGTCAGCAAGTGAACATTATCATCGCTGTCGTCCTTTTGCAAACAATCGCTCTTTACTACCAGCGACCAGAACAA
AGGTCGTTTTCTAACACTTATCACGCGATCCTTGTTACGATGATTCGCCGTATCAGGCTCATTGATCGGGTCTCG
GCATGGAGCCCTCCAGACCTTACTGATGTTAGTGGACTGGACAAAGCATGGAAAGCCTGGGCGCAGTATGAAACA
ATCAAACGGGCGCTTTTCGTTTCGTACCTGCACGATTGCTGTCACTGCTTATATTTCTCCTTGCCGCCGTCGTTT
CAGCCTAGCGAATTGGATATCAATCTGCCATGTGATGACGGGATATGGGCAGCGGGTAGTGCAGCACAGTGGCTA
CAAGCTATCAAGTCGCCCTCTCAATATGGAGTTGGAATGGCAAGGCTCTCTGGTTTCAGCATGCAACGTGCATTA
GCGACATTAAGCGGAGCGCAGTCACCGGCAACTCTCCCTGCACTCAATCCCTTCGCCCATTTCATCCTCATTCAC
ACCATTATTCGGGACCTATATGTCTCGAGTGCTCGAGATCGTCCCGATGGCTCACCTACGGACACGACGAGAGAC
AGCGGGATAACTACCTCTACACAACGTGCTCTCCAAACCTGGACTCAGATGTGGGTCAATAGTCCCGATGCGACG
CGCTACGATAACAACCGGGAGGAAGCACCTTTTGTCTACAATGCCCTCCCTTTCTTTTGGCTGGCTCAAGTGTCA
CTGATGGTCCTTCAGGAGGATTCTGGTGTTGACACTAAACTGATCGAACCTCAGAATGAGGCCGGATTTCGTTTC
TTGAAGGAATGGCTTGCGAGACTCCGGTACCATCTCCGAAACGGAACACAGATCCCTCCTCAGCTTTGGGATGAG
TTGATGAAAATTCGTACGCAACTTCAACTGCAGCAGGCAGACCGGAGTAATTGTGAGCAAGCCTGCGGCTTGGTC
GACATCTATCAGAAGAGTTAA
Gene >Agabi119p4|105090
ATGCCCGCTGTAAGGCATTCGATAGACCTTAAAGCTAACGGAGAGGTTAGCCGTATGCGCCACCATAAAGGTAAG
TTGTCCTCAACTGGCCATTGAAGTACGCTAAAAAATCACTCATAGGTAACATGCCCTCCCTGCCACAGACAAAAT
TTTGTTCTCTATGTCCTGCCAAATTCACTCGCACCACACATCTCAATCGCCACCTACGTTCACGTGTGTCTTCTT
TTCCCACAAGAGTTGAACAGCCACTGATCAACTTCTTTTCCAGATACAAACGAACGGTTGCATCGATGTAACGTA
TGTTGTTCGACTTTGCGAGAACAATATTGGTATTGACGACCCTTGTAGACATGTAATGCAGAATTCACACGGAGC
GATTTGCTTACACGACATAAGCGAACATGCGGCGACTCGTGAGTATCAACTATTCTAGTTCATCTGTTTGCGGCA
GCAACTCATTGATCCAATTCTTAGCCGAAATGCTAACCGGTCGCGGCGCAAGTCCTGTCAGGTATGACTCCTTTG
TCTGAAAGCTGTTCAACTAACTGATGCTGTCTTACCTGTAGGCGTGCGCAGAATCGAAGGTCAAATGCAATTTGC
AATATCCCTGCTCCAAGTGCTCGTCGAGAGGAAGAGAATGCGTATTCATTAACGATCCGGAGGCGTCAAGGAACA
AACGTAATGCAGCAAAGAGAGCAATGCAGCAAGCTGCTGCCGCCAAAGCTGCAGGTGATCCTACAATGTCGGAAA
CACCTTCGTCAATGTCATCGAAATCTTCACCTCCGTACACCTCGCTTTTGATGCATACCCCGTCGCCGACACTTT
CGTTGGATAGTCAGCTATTATCCCTCGCTCCCTTCGAACTTCCGGGCCTCTCGACCTCCTCGAGCTCTTCCATTG
CCTCAAGCGGGTCATCTCCTCGGTCAGATCTCCTTGAACCTCGCGGAGACTTTGCGCCATCCTTCCAGGTTTCGG
CTTTTGATACTTTAAGCTTGGATAACCAGCTGAACAGACTTTTCCCCAACTCTACGTCGTGCTTTGACAATTTCG
GCATACAATCATCATTCTCTCCACCTTCTGGACCGTTCCAAGAACTATCGACATGGCTGGATGGCGGTGAACAGC
TACAGAAGTATGGAGATAACGATATGATCTCTTATGCCCATGCATCCCATGAAATCAAGGTAGAGGGCCAGGATA
ACCTTCAAGAATATGGCCCACCGGGACTGCCTTTTTCCTTAAACACTATCATCAACCCAACAGGAGGTCTCTCCG
ATCCCTCGGCTCTCTCCAGTGCTCCCGAACCCACGCCCGAGGAGTTAGAACACTATCGTGTGTTTAATTTTCTTG
CACACAAAAGCATACATTGATTTGATCGTTTTCGTATAGTATACCTCTTTTTCTCTGCGTTTGGCACTCAAATAC
CTCTTGTCCACCCTTCTACGTGGAAGCCGGAAGGCAAACCTCCGGTCCTCATTCGTGCCATGCAAGCATGCGGAG
CGCTATTTGTCAAAACGAAGACAGCAACAAATTTTGTCAATGATACTCTAGCAGAAACGCGGGATGTTCTAATCG
CGGAATTCGTACGTGCTTTTGTGGTACCCTTTCTTGGAACTTTGGATCTTACATATCGGTTTGACAGACCAACTC
TGGCTCAGATTTGAGTCAGCAAGTGAACATTATCATCGCTGTCGTCCTTTTGCAAACAATCGCTCTTTACTACCA
GCGACCAGAACAAAGGTCGTTTTCTAACACTTATCACGCGATCCTTGTTACGGTATGAGCACTTACTTTCGTACG
ATTATATCGGCTAATGAATGCCTATGATCCAGATGATTCGCCGTATCAGGCTCATTGATCGGGTCTCGGCATGGA
GCCCTCCAGACCTTACTGATGTTAGTGGACTGGACAAAGCATGGAAAGCCTGGGCGCAGTATGAAACAATCAAAC
GGTCAGCCAAATACCTTGATTCTGTTCATCTAGACTTTTACTTATGCATCAACAGGGCGCTTTTCGTTTCGTACC
TGCACGATTGCTGTCACTGCTTATATTTCTCCTTGCCGCCGTCGTTTCAGCCTAGCGAATTGGATATCAATCTGC
CATGTGATGACGGGATATGGGCAGCGGGTAGTGCAGCACAGTGGCTACAAGCTATCAAGTCGCCCTCTCAATATG
GAGTTGGAATGGCAAGGCTCTCTGGTTTCAGCATGCAACGTGCATTAGCGACATTAAGCGGAGCGCAGTCACCGG
CAACTCTCCCTGCACTCAATCCCTTCGCCCATTTCATCCTCATTCACACCATTATTCGGGACCTATATGTCTCGA
GTGCTCGAGATCGTCCCGATGGCTCACCTACGGACACGACGAGAGACAGCGGGATAACTACCTCTACACAACGTG
CTCTCCAAACCTGGACTCAGATGTGGGTCAATAGTCCCGATGCGACGCGCTACGATAACAACCGGGAGGAAGCAC
CTTTTGTCTACAATGCCCTCCCTTTCTTTTGGCTGGCTCAAGTGTCACTGATGGTCCTTCAGGAGGATTCTGGTG
TTGACACTAAACTGATCGAACCTCAGAATGAGGCCGGATTTCGTTTCTTGAAGGAATGGCTTGCGAGACTCCGGT
ACCATCTCCGAAACGGAACACAGATCCCTCCTCAGCTTTGGGATGAGTTGATGAAAATTCGTACGCAACTTCAAC
TGCAGCAGGCAGACCGGAGTAATTGTGAGCAAGCCTGCGGCTTGGTCGACATCTATCAGAAGAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail