Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|104620
Gene name
Locationscaffold_07:1785637..1786642
Strand-
Gene length (bp)1005
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01753 zf-MYND MYND finger 5.6E-09 37 78

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5ZMD2|ANKY2_CHICK Ankyrin repeat and MYND domain-containing protein 2 OS=Gallus gallus GN=ANKMY2 PE=2 SV=1 19 79 7.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|104620
MPTTQVRKPTLYDHLALQLTRSVLSHRNFSKTTTQSCYLCHKNGTKKKPLKSCSSCKSALYCSLECQRTHWRTHK
EYCKESFYEERLVLTDIMIAIGNALNIDALPLPKPPPGLTWIELEARFKKWLLFHAKTLIAAAMHALQIPDDRST
THVLFIKTKYRNNSVEVAKCFSLIKAEVLTLEEVKSWGGHLMQELEATYRCCRFTMYFCIPA*
Coding >Agabi119p4|104620
ATGCCTACAACGCAAGTTCGAAAGCCGACTCTCTATGATCACCTTGCTCTTCAGCTCACTCGTAGTGTTCTCTCA
CACCGAAATTTCTCAAAGACTACAACTCAATCTTGTTATCTATGTCACAAGAATGGGACAAAGAAGAAGCCACTG
AAATCGTGTTCGAGCTGCAAGTCTGCTTTGTATTGTTCACTTGAGTGTCAACGAACACATTGGCGTACACATAAA
GAATACTGCAAAGAATCATTCTATGAAGAACGTCTGGTACTTACCGACATCATGATCGCAATAGGCAATGCCCTC
AATATTGATGCACTTCCCCTTCCAAAACCACCACCCGGTTTGACCTGGATCGAACTTGAAGCCCGTTTCAAGAAA
TGGCTCCTTTTCCACGCAAAGACATTGATCGCTGCAGCCATGCATGCCCTGCAAATCCCCGACGACCGCTCGACT
ACCCATGTGCTTTTCATAAAAACCAAATACCGCAATAATAGCGTCGAAGTCGCGAAATGCTTTTCATTGATAAAA
GCAGAGGTCTTGACGCTAGAAGAGGTGAAAAGTTGGGGAGGACACCTTATGCAGGAATTGGAAGCGACTTATAGA
TGTTGTCGATTCACCATGTACTTTTGTATTCCAGCTTGA
Transcript >Agabi119p4|104620
ATGCCTACAACGCAAGTTCGAAAGCCGACTCTCTATGATCACCTTGCTCTTCAGCTCACTCGTAGTGTTCTCTCA
CACCGAAATTTCTCAAAGACTACAACTCAATCTTGTTATCTATGTCACAAGAATGGGACAAAGAAGAAGCCACTG
AAATCGTGTTCGAGCTGCAAGTCTGCTTTGTATTGTTCACTTGAGTGTCAACGAACACATTGGCGTACACATAAA
GAATACTGCAAAGAATCATTCTATGAAGAACGTCTGGTACTTACCGACATCATGATCGCAATAGGCAATGCCCTC
AATATTGATGCACTTCCCCTTCCAAAACCACCACCCGGTTTGACCTGGATCGAACTTGAAGCCCGTTTCAAGAAA
TGGCTCCTTTTCCACGCAAAGACATTGATCGCTGCAGCCATGCATGCCCTGCAAATCCCCGACGACCGCTCGACT
ACCCATGTGCTTTTCATAAAAACCAAATACCGCAATAATAGCGTCGAAGTCGCGAAATGCTTTTCATTGATAAAA
GCAGAGGTCTTGACGCTAGAAGAGGTGAAAAGTTGGGGAGGACACCTTATGCAGGAATTGGAAGCGACTTATAGA
TGTTGTCGATTCACCATGTACTTTTGTATTCCAGCTTGA
Gene >Agabi119p4|104620
ATGCCTACAACGCAAGTTCGAAAGCCGACTCTCTATGATCACCTTGCTCTTCAGCTCACTCGTAGTGTTCTCTCA
CACCGAAATTTCTCAAAGACTACAACTCAATCTTGTTATCTATGTCACAAGAATGGGACAAAGAAGAAGCCACTG
AAATCGTGTTCGAGCTGCAAGTCTGCTTTGTGAGTTGACAGTCTATTGCGAATTGCCTACTCTTATACTCATAAC
CAACATCTTAGGTATTGTTCACTTGAGTGTCAACGAACACATTGGCGTGTACGAAGCACTGTTTACCATGATAAC
GTTCTTCACATTTACTCATTCGTTCCACTAAAGACACATAAAGAATACTGCAAAGAATCATTCTATGAAGAACGT
CTGGTACTTACCGACATCATGATCGCAATAGGCAATGCCCTCAATATTGATGCACTTCCCCTTCCAAAACCACCA
CCCGGTTTGACCTGGATCGAACTTGAAGCCCGTTTCAAGAAATGGCTCCTTTTCCACGCAAAGACATTGATCGCT
GCAGCCATGCATGCCCTGCAAATCCCCGACGACCGCTCGACTACCCATGTGCTTTTCATAAAAACCAAATACCGC
AATAATAGCGTCGAAGTCGCGAAATGCTTTTCATTGATAAAAGCAGAGGTCTTGACGCTAGAAGAGGTGAAAAGT
TGGGGAGGACACCTTATGCAGGAATTGGAAGCGGTGCGAATAGATCAAGAAAAAACGGGCGGTAAACCGATTATC
GGGGTGTTATTCGAAAGTTCGCCGATGAGGTTACAAGTCGTCCCTGTCGCATCTTTCAAGAAGTTATCCATTGCA
TATTTGCCTTGGATATCGAATTGGAAGGATATCCTGAAGAACCGTCTTGAAAACGGCACAGACTTATAGGTTGGC
AGAGTTCTTCCAATTTCGCACTTGCCACTTTCATGACTGCTGACTCATTCGTGTAATTCTATCAGATGTTGTCGA
TTCACCATGTACTTTTGTATTCCAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail