Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|104330
Gene name
Locationscaffold_07:1706501..1709043
Strand+
Gene length (bp)2542
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16499 Melibiase_2 Alpha galactosidase A 1.1E-54 27 309
PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain 2.6E-11 323 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0YEK2|AGALD_ASPFC Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aglD PE=3 SV=2 6 431 3.0E-121
sp|A4DA70|AGALD_ASPFU Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglD PE=3 SV=2 6 431 3.0E-121
sp|A2R2S6|AGALD_ASPNC Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglD PE=3 SV=2 20 435 8.0E-121
sp|Q0CVX4|AGALD_ASPTN Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglD PE=3 SV=2 14 409 1.0E-119
sp|A1D9S3|AGALD_NEOFI Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglD PE=3 SV=1 11 431 5.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0YEK2|AGALD_ASPFC Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aglD PE=3 SV=2 6 431 3.0E-121
sp|A4DA70|AGALD_ASPFU Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglD PE=3 SV=2 6 431 3.0E-121
sp|A2R2S6|AGALD_ASPNC Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglD PE=3 SV=2 20 435 8.0E-121
sp|Q0CVX4|AGALD_ASPTN Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglD PE=3 SV=2 14 409 1.0E-119
sp|A1D9S3|AGALD_NEOFI Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglD PE=3 SV=1 11 431 5.0E-119
sp|Q2UI87|AGALD_ASPOR Probable alpha-galactosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglD PE=3 SV=2 20 431 7.0E-118
sp|B8N7Z0|AGALD_ASPFN Probable alpha-galactosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglD PE=3 SV=1 20 431 2.0E-114
sp|Q5AX28|AGALD_EMENI Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglD PE=1 SV=2 20 435 2.0E-113
sp|P14749|AGAL_CYATE Alpha-galactosidase OS=Cyamopsis tetragonoloba PE=1 SV=1 21 396 2.0E-92
sp|Q8VXZ7|AGAL3_ARATH Alpha-galactosidase 3 OS=Arabidopsis thaliana GN=AGAL3 PE=1 SV=1 18 390 9.0E-88
sp|Q8RX86|AGAL2_ARATH Alpha-galactosidase 2 OS=Arabidopsis thaliana GN=AGAL2 PE=1 SV=1 18 396 5.0E-87
sp|Q42656|AGAL_COFAR Alpha-galactosidase OS=Coffea arabica PE=1 SV=1 20 388 1.0E-84
sp|Q9FXT4|AGAL_ORYSJ Alpha-galactosidase OS=Oryza sativa subsp. japonica GN=Os10g0493600 PE=1 SV=1 20 396 7.0E-83
sp|Q9FT97|AGAL1_ARATH Alpha-galactosidase 1 OS=Arabidopsis thaliana GN=AGAL1 PE=2 SV=1 20 396 7.0E-81
sp|Q99172|MEL_LACCI Alpha-galactosidase OS=Lachancea cidri GN=MEL PE=3 SV=1 22 373 2.0E-75
sp|B3PGJ1|AGAL_CELJU Alpha-galactosidase A OS=Cellvibrio japonicus (strain Ueda107) GN=agaA PE=1 SV=1 12 343 6.0E-73
sp|Q55B10|AGAL_DICDI Probable alpha-galactosidase OS=Dictyostelium discoideum GN=melA PE=3 SV=1 1 398 2.0E-72
sp|Q11129|MEL_SACMI Alpha-galactosidase OS=Saccharomyces mikatae GN=MEL PE=3 SV=1 6 373 2.0E-70
sp|Q9P4V4|MEL_ZYGMR Alpha-galactosidase OS=Zygotorulaspora mrakii GN=MEL PE=3 SV=1 22 358 2.0E-70
sp|A7XZT2|AGALB_TALEM Probable alpha-galactosidase B OS=Talaromyces emersonii PE=3 SV=1 17 397 2.0E-68
sp|Q03647|MEL_SACCA Alpha-galactosidase OS=Saccharomyces pastorianus (strain ATCC 76529 / Carlsberg bottom yeast no.1 / CBS 1513 / CLIB 176 / NBRC 1167 / NCYC 396 / NRRL Y-12693) GN=MEL PE=3 SV=1 6 362 4.0E-67
sp|A1C5D3|AGALB_ASPCL Probable alpha-galactosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aglB PE=3 SV=1 2 393 1.0E-66
sp|O94221|AGALB_PENSI Probable alpha-galactosidase B OS=Penicillium simplicissimum GN=agl1 PE=2 SV=1 17 393 3.0E-66
sp|P41946|MEL5_YEASX Alpha-galactosidase 5 OS=Saccharomyces cerevisiae GN=MEL5 PE=3 SV=1 22 362 2.0E-65
sp|A2QEJ9|AGALB_ASPNC Probable alpha-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglB PE=3 SV=1 10 397 2.0E-65
sp|P41947|MEL6_YEASX Alpha-galactosidase 6 OS=Saccharomyces cerevisiae GN=MEL6 PE=3 SV=1 22 362 2.0E-65
sp|Q9UVD6|MEL_TORDE Alpha-galactosidase OS=Torulaspora delbrueckii GN=MEL PE=3 SV=1 22 373 9.0E-65
sp|P04824|MEL1_YEASX Alpha-galactosidase 1 OS=Saccharomyces cerevisiae GN=MEL1 PE=1 SV=1 22 362 2.0E-64
sp|Q9Y865|AGALB_ASPNG Probable alpha-galactosidase B OS=Aspergillus niger GN=aglB PE=2 SV=1 10 397 3.0E-64
sp|B8N306|AGALB_ASPFN Probable alpha-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglB PE=3 SV=1 17 393 3.0E-63
sp|Q09187|MEL_SACPA Alpha-galactosidase OS=Saccharomyces paradoxus GN=MEL PE=3 SV=1 17 408 4.0E-63
sp|P41945|MEL2_YEASX Alpha-galactosidase 2 OS=Saccharomyces cerevisiae GN=MEL2 PE=3 SV=1 22 362 4.0E-63
sp|Q2UJ97|AGALB_ASPOR Probable alpha-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglB PE=3 SV=1 17 393 1.0E-62
sp|Q9URZ0|AGAL_SCHPO Alpha-galactosidase mel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mel1 PE=3 SV=1 22 395 3.0E-60
sp|A1D0A3|AGALB_NEOFI Probable alpha-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglB PE=3 SV=1 24 393 1.0E-59
sp|Q4WE86|AGALB_ASPFU Probable alpha-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglB PE=3 SV=2 24 393 2.0E-58
sp|B0Y224|AGALB_ASPFC Probable alpha-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aglB PE=3 SV=1 26 393 2.0E-58
sp|Q5AVQ6|AGALB_EMENI Probable alpha-galactosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglB PE=2 SV=2 22 393 2.0E-55
sp|P51569|AGAL_MOUSE Alpha-galactosidase A OS=Mus musculus GN=Gla PE=1 SV=1 17 346 2.0E-55
sp|P06280|AGAL_HUMAN Alpha-galactosidase A OS=Homo sapiens GN=GLA PE=1 SV=1 15 359 6.0E-55
sp|Q90744|NAGAB_CHICK Alpha-N-acetylgalactosaminidase OS=Gallus gallus GN=NAGA PE=1 SV=1 20 395 2.0E-54
sp|P17050|NAGAB_HUMAN Alpha-N-acetylgalactosaminidase OS=Homo sapiens GN=NAGA PE=1 SV=2 17 395 9.0E-54
sp|Q58DH9|NAGAB_BOVIN Alpha-N-acetylgalactosaminidase OS=Bos taurus GN=NAGA PE=2 SV=1 17 395 2.0E-52
sp|P28351|AGALA_ASPNG Alpha-galactosidase A OS=Aspergillus niger GN=aglA PE=1 SV=1 24 424 9.0E-49
sp|A2QL72|AGALA_ASPNC Probable alpha-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglA PE=3 SV=1 28 424 1.0E-48
sp|Q9QWR8|NAGAB_MOUSE Alpha-N-acetylgalactosaminidase OS=Mus musculus GN=Naga PE=1 SV=2 20 312 1.0E-47
sp|Q66H12|NAGAB_RAT Alpha-N-acetylgalactosaminidase OS=Rattus norvegicus GN=Naga PE=2 SV=1 20 395 4.0E-47
sp|Q0CPK2|AGALA_ASPTN Probable alpha-galactosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglA PE=3 SV=2 21 423 9.0E-47
sp|A1CBW8|AGALA_ASPCL Probable alpha-galactosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aglA PE=3 SV=1 5 343 3.0E-46
sp|B8MWJ5|AGALA_ASPFN Probable alpha-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglA PE=3 SV=1 21 395 5.0E-45
sp|Q2UT06|AGALA_ASPOR Probable alpha-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglA PE=3 SV=1 21 395 1.0E-44
sp|A1DDD8|AGALA_NEOFI Probable alpha-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglA PE=3 SV=1 13 343 3.0E-44
sp|Q4WVZ3|AGALA_ASPFU Probable alpha-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglA PE=3 SV=1 24 343 3.0E-44
sp|Q0CVX4|AGALD_ASPTN Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglD PE=3 SV=2 405 535 2.0E-06
sp|C8VJZ7|AGAL8_EMENI Putative alpha-galactosidase 8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agl8 PE=5 SV=2 31 287 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|104330
MLKAPYVYIAFLLSPLVLALNDGLARTPPMGWNPYNAFLCSTTEQQYRTAAQKLIDLGLSEVGYQFVNLDCGWQG
KARNASGGFTWDTTAFPSGIPALSTFIHNLGLKFGVYSDGGFFSCDFVGGTAHYIGSLGHETSDANSFAAWGADY
LKYDNCYSVSPTDFVNFNPPIQIEPHYVTMRDALAATSRPVIFSICEWGVQDPARWPASAVGHSWRISNDIGPPA
SWDNLFRIINQVVPLTQFAGPGGWNDLDMLEVGNSGLTTVEQQTHFAFWAAVKSPLLISTDLTRIASNSLNILKN
NRIIALNQDRLGKSISFKRRYTNDHDVWSGPLADGAFVAVIINWQNTRRSLTFNLADVGLSSADATDLISGSFLG
RINQSHTAVLEPHGVMVLKLSGTLTVAPQPSFQFYMAASSKNTLTGGANIRAVTSSVSVVGFIGNGGKLVFNEVD
GGSIGGTKLVSIDYINADFVFSNTACSNCRNAFISVNGGTPVQAQMPISGQSWDIIFSGYLVSLSGFKAGKTNTI
EISNPSAFTPDFYRIGVST*
Coding >Agabi119p4|104330
ATGCTGAAGGCGCCTTACGTATATATCGCATTTCTTTTATCTCCTTTAGTCCTAGCACTTAACGATGGCCTCGCG
AGGACACCTCCCATGGGCTGGAACCCATACAATGCATTTTTATGTTCGACAACAGAGCAACAATATCGAACGGCA
GCTCAGAAATTGATTGATTTAGGCCTGAGCGAAGTAGGCTATCAATTTGTCAACCTCGATTGCGGCTGGCAAGGC
AAAGCTAGAAATGCTAGCGGTGGCTTTACCTGGGACACAACAGCGTTCCCATCAGGAATTCCGGCGCTTTCTACT
TTTATCCACAACCTTGGCCTCAAATTCGGAGTTTATTCTGATGGGGGTTTCTTTAGCTGCGATTTTGTGGGAGGT
ACAGCGCATTACATTGGAAGCCTTGGACATGAGACCTCGGACGCGAACAGCTTTGCTGCCTGGGGAGCAGATTAC
CTAAAATACGACAATTGTTATTCTGTTAGCCCTACGGATTTCGTCAACTTTAATCCCCCTATCCAGATTGAACCT
CACTATGTAACTATGCGGGACGCCCTTGCCGCCACAAGTCGGCCGGTTATATTTTCGATCTGTGAATGGGGCGTA
CAAGATCCCGCCCGGTGGCCTGCGAGTGCTGTCGGTCATTCTTGGCGGATTTCCAATGACATCGGTCCTCCAGCT
TCATGGGATAATCTTTTCCGAATTATAAACCAAGTCGTGCCTCTGACGCAATTTGCTGGACCAGGTGGATGGAAC
GATTTGGATATGCTTGAGGTCGGGAACTCTGGATTAACGACAGTGGAACAACAGACACACTTTGCCTTCTGGGCT
GCAGTGAAGTCTCCTTTACTTATATCTACCGACCTCACACGAATTGCATCAAACTCTCTAAACATCTTGAAGAAC
AATAGGATCATCGCTCTTAACCAAGATCGACTAGGAAAATCAATTAGCTTCAAGCGACGATACACTAACGACCAC
GACGTTTGGTCCGGTCCCCTCGCCGACGGAGCCTTCGTGGCCGTTATCATCAACTGGCAGAACACCCGTCGGTCT
CTGACATTCAACCTTGCGGATGTTGGCCTTTCTTCCGCAGATGCCACTGATTTGATTTCCGGCTCTTTCTTGGGT
AGAATTAATCAATCACATACAGCCGTCTTGGAACCCCATGGTGTCATGGTCTTAAAACTCAGCGGAACACTTACT
GTCGCGCCTCAACCGTCATTCCAATTCTATATGGCAGCATCTTCTAAGAACACACTTACAGGAGGAGCCAATATC
CGAGCTGTCACATCTTCTGTATCTGTTGTAGGATTTATTGGAAATGGTGGGAAACTTGTCTTTAACGAGGTCGAT
GGCGGATCTATTGGTGGTACCAAACTCGTATCGATCGACTATATAAATGCAGATTTCGTATTCAGCAATACCGCA
TGTTCGAATTGCCGTAATGCGTTTATTAGCGTTAATGGAGGAACACCTGTCCAAGCTCAGATGCCTATCTCTGGT
CAGAGCTGGGATATCATCTTTTCTGGGTACCTTGTTTCCCTCTCCGGGTTCAAGGCCGGGAAAACGAATACTATT
GAGATCTCGAATCCTTCCGCTTTCACCCCCGATTTTTATCGTATTGGAGTATCGACTTGA
Transcript >Agabi119p4|104330
ATGCTGAAGGCGCCTTACGTATATATCGCATTTCTTTTATCTCCTTTAGTCCTAGCACTTAACGATGGCCTCGCG
AGGACACCTCCCATGGGCTGGAACCCATACAATGCATTTTTATGTTCGACAACAGAGCAACAATATCGAACGGCA
GCTCAGAAATTGATTGATTTAGGCCTGAGCGAAGTAGGCTATCAATTTGTCAACCTCGATTGCGGCTGGCAAGGC
AAAGCTAGAAATGCTAGCGGTGGCTTTACCTGGGACACAACAGCGTTCCCATCAGGAATTCCGGCGCTTTCTACT
TTTATCCACAACCTTGGCCTCAAATTCGGAGTTTATTCTGATGGGGGTTTCTTTAGCTGCGATTTTGTGGGAGGT
ACAGCGCATTACATTGGAAGCCTTGGACATGAGACCTCGGACGCGAACAGCTTTGCTGCCTGGGGAGCAGATTAC
CTAAAATACGACAATTGTTATTCTGTTAGCCCTACGGATTTCGTCAACTTTAATCCCCCTATCCAGATTGAACCT
CACTATGTAACTATGCGGGACGCCCTTGCCGCCACAAGTCGGCCGGTTATATTTTCGATCTGTGAATGGGGCGTA
CAAGATCCCGCCCGGTGGCCTGCGAGTGCTGTCGGTCATTCTTGGCGGATTTCCAATGACATCGGTCCTCCAGCT
TCATGGGATAATCTTTTCCGAATTATAAACCAAGTCGTGCCTCTGACGCAATTTGCTGGACCAGGTGGATGGAAC
GATTTGGATATGCTTGAGGTCGGGAACTCTGGATTAACGACAGTGGAACAACAGACACACTTTGCCTTCTGGGCT
GCAGTGAAGTCTCCTTTACTTATATCTACCGACCTCACACGAATTGCATCAAACTCTCTAAACATCTTGAAGAAC
AATAGGATCATCGCTCTTAACCAAGATCGACTAGGAAAATCAATTAGCTTCAAGCGACGATACACTAACGACCAC
GACGTTTGGTCCGGTCCCCTCGCCGACGGAGCCTTCGTGGCCGTTATCATCAACTGGCAGAACACCCGTCGGTCT
CTGACATTCAACCTTGCGGATGTTGGCCTTTCTTCCGCAGATGCCACTGATTTGATTTCCGGCTCTTTCTTGGGT
AGAATTAATCAATCACATACAGCCGTCTTGGAACCCCATGGTGTCATGGTCTTAAAACTCAGCGGAACACTTACT
GTCGCGCCTCAACCGTCATTCCAATTCTATATGGCAGCATCTTCTAAGAACACACTTACAGGAGGAGCCAATATC
CGAGCTGTCACATCTTCTGTATCTGTTGTAGGATTTATTGGAAATGGTGGGAAACTTGTCTTTAACGAGGTCGAT
GGCGGATCTATTGGTGGTACCAAACTCGTATCGATCGACTATATAAATGCAGATTTCGTATTCAGCAATACCGCA
TGTTCGAATTGCCGTAATGCGTTTATTAGCGTTAATGGAGGAACACCTGTCCAAGCTCAGATGCCTATCTCTGGT
CAGAGCTGGGATATCATCTTTTCTGGGTACCTTGTTTCCCTCTCCGGGTTCAAGGCCGGGAAAACGAATACTATT
GAGATCTCGAATCCTTCCGCTTTCACCCCCGATTTTTATCGTATTGGAGTATCGACTTGA
Gene >Agabi119p4|104330
ATGCTGAAGGCGCCTTACGTATATATCGCATTTCTTTTATCTCCTTTAGTCCTAGCACTTAACGATGGCCTCGCG
AGGACACCTCCCATGGGCTGGAACCCATACAATGCATTTTTGTGAGCAGCATCTTCACTTTCTCTGGCTGGGTTT
TACGCGAACTCTTTCGCAGATGTTCGACAACAGAGCAACAATATCGAACGGCAGCTCAGAAATTGATTGATTTAG
GCCTGAGCGAAGTAGGCTATCAATTTGTCAACCTGTAATGCGGGTTTTACCATTCTCGTCTCGATAACATTGTTG
ATCTAACTTGAAAAGCGATTGCGGCTGGCAAGGCAAAGCTAGAAATGCTAGCGGTGGCTTTACCTGGGACACAAC
AGCGTTCCCATCAGGAATTCCGGCGCTTTCTACTTTTATCCACAACCTTGGCCTCAAATTCGGAGTTTATTCTGA
TGGGTTAGTACTTCTCCTTGACAGCACGAATTCCATGTAACTGTGGAATTTCAGGGGTTTCTTTAGCTGCGATTT
TGTGGGAGGTACAGCGCATTACATTGGAAGCCTTGGACATGAGACCTCGGACGCGAACAGCTTTGCTGCCTGGGG
AGCAGATTACCTAAAAGTATGTTCAAACATTCACGTATTCGTTCATCGGGCCTCACATAATCTCTCAGTACGACA
ATTGTTATTCTGGTAGTGTTTCTTATACTCCGCCATACTTTAAGTTCCGCTCACCGTTACATGCAGTTAGCCCTA
CGGATTTCGTCAACTTTAATCCCCCTATCCAGGTGTGTACCAAGGTATAATGTTTTTGGCATGAAGCTGATTCTC
TTCTCGATTCAGATTGAAGTAAGTTTTTACCAGGACCTTCATTCCGAATATGCTTTGAACTCAAACTGTTATGCG
TTAGCCTCACTATGTAACTATGCGGGACGCCCTTGCCGCCACAAGTCGGCCGGTTATATTTTCGATCTGTGAATG
GGGCGTACAAGGTAAGCTTTCTCGTGTCAGATTGTTTATTTGTTGACAACAGAGTAGATCCCGCCCGGTGGCCTG
CGAGTGCTGTCGGTCATTCGTGAGTATCACTCACTTTATTCAAATTGCAAGGTAATGACGATAACTGCTCCCAGT
TGGCGGATTTCGTGAGTTACGTCGTGATATACTTGATCTACTCCAACCAGCCGCTGTAGCAATGACATCGGTCCT
CCAGCTTCATGGGATAATCTTTTCCGAATTATAAACCAAGTCGTGCCTCTGACGCAATTTGCTGGACCAGGTGGA
TGGAACGGTGAGTTTATCTTTCTATTCACCTGTGTCAATTGGTTGCCAATAGATTTGGCGAATAGATTTGGATAT
GCTTGAGGTCGGGAACTCTGGATTAACGACAGTGGAACAACAGACACACTTTGCCTTCTGGGCTGCAGTGAAGTG
GGCTCGACCAATAATCGCTTAACGAATCTTATATTTGAATCCTAGGTCTCCTTTACTTATATCTACCGACCTCAC
ACGAATTGCATCAAACTCTCTAAACATCTTGAAGAACAATAGGATCATCGCTCTTAACGTAAGCTCATTCGTGGA
TACTGTCTCGTCATTCATTTCTTGATTTATTGTAACACAAATAGCAAGATCGACTAGGAAAATCAATTAGCTTCA
AGCGACGATACACTAACGACCACGACGTTTGGTCCGGTCCCCTCGCCGACGGAGCCTTCGTGGCCGGTAAGGATT
CATCTCTTTCATGTTGCTGCTATCTACTCATCCTTATGTTTAACTTCGGAATCTACTTTCAGTTATCATCAACTG
GCAGAACACCCGTCGGTCTCTGACATTCAACCTTGCGGATGTTGGCCTTTCTTCCGCAGATGCCACTGATTTGAT
TTCCGGCTCTTTCTTGGGTAGAATTAATCAATCGTGGGTATCATCATTCATTTTGACCGGAACATATCTATGCAT
GTTCTTCTTCAAGCAGACTCTAACATTTTGGATAGACATACAGCCGTCTTGGAACCCCATGGTGTCATGGTCTTA
AAACTCAGCGGAACACTTACTGTCGCGCCTCAACCGTCATTCCAATTCTATATGGCAGCATCTTCTAAGAACACA
CTTACAGGAGGAGCCAATATCCGAGCTGTCACATCTTCTGTATCTGTTGTAGGATTTATTGGAAATGGTGGGAAA
CTTGTCTTTAACGAGGTCGATGGCGGATCTATTGGTGGTACCAAACTCGTATCGATCGACTATATAAATGCAGAT
TTCGTATTCAGCAATACCGCATGTTCGAATTGCCGTAATGCGTTTATTAGCGTTAATGGAGGAACACCTGTCCAA
GCTCAGATGCCTATCTCTGGTCAGGTAGGCAAAGTTTTGGTTTTTCTAATTTATTTTTCGTGTTCACCTTTTTTT
CTTGTGACAGAGCTGGGATATCATCTTTTCTGGGTACCTTGTTTCCCTCTCCGGGTTCAAGGCCGGGAAAACGAA
TACTATTGAGATCTCGAATCCTTCCGCTTTCACCCCCGATTTTTATCGTATTGGAGTATCGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail