Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|104310
Gene name
Locationscaffold_07:1700908..1704436
Strand-
Gene length (bp)3528
Transcript length (bp)2247
Coding sequence length (bp)2247
Protein length (aa) 749

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 9.1E-18 25 190
PF00271 Helicase_C Helicase conserved C-terminal domain 1.3E-16 240 350
PF16124 RecQ_Zn_bind RecQ zinc-binding 3.2E-09 390 443

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 11 448 2.0E-97
sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 11 453 8.0E-97
sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 11 453 1.0E-96
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 12 442 2.0E-96
sp|Q9I920|BLM_CHICK Bloom syndrome protein homolog (Fragment) OS=Gallus gallus GN=BLM PE=2 SV=1 11 472 1.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 11 448 2.0E-97
sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 11 453 8.0E-97
sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 11 453 1.0E-96
sp|Q09811|HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rqh1 PE=1 SV=1 12 442 2.0E-96
sp|Q9I920|BLM_CHICK Bloom syndrome protein homolog (Fragment) OS=Gallus gallus GN=BLM PE=2 SV=1 11 472 1.0E-95
sp|Q9DEY9|BLM_XENLA Bloom syndrome protein homolog OS=Xenopus laevis GN=blm PE=2 SV=1 11 442 2.0E-93
sp|Q8VID5|RECQ5_MOUSE ATP-dependent DNA helicase Q5 OS=Mus musculus GN=Recql5 PE=1 SV=1 10 455 1.0E-91
sp|O94762|RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=RECQL5 PE=1 SV=2 10 455 1.0E-89
sp|D4ACP5|RECQ5_RAT ATP-dependent DNA helicase Q5 OS=Rattus norvegicus GN=Recql5 PE=1 SV=1 10 455 3.0E-89
sp|Q9VGI8|BLM_DROME Bloom syndrome protein homolog OS=Drosophila melanogaster GN=Blm PE=1 SV=1 12 437 6.0E-89
sp|O18017|BLM_CAEEL Bloom syndrome protein homolog OS=Caenorhabditis elegans GN=him-6 PE=2 SV=2 10 455 7.0E-89
sp|P35187|SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGS1 PE=1 SV=1 12 445 4.0E-88
sp|Q9FT70|RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1 13 523 1.0E-85
sp|P46063|RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 4 588 1.0E-85
sp|Q5RF63|RECQ1_PONAB ATP-dependent DNA helicase Q1 OS=Pongo abelii GN=RECQL PE=2 SV=1 4 552 2.0E-85
sp|Q9Z129|RECQ1_MOUSE ATP-dependent DNA helicase Q1 OS=Mus musculus GN=Recql PE=1 SV=2 9 552 4.0E-83
sp|Q8L840|RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1 13 470 6.0E-83
sp|A8WK63|RECQ1_CAEBR Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis briggsae GN=CBG24191 PE=3 SV=1 11 448 2.0E-82
sp|P15043|RECQ_ECOLI ATP-dependent DNA helicase RecQ OS=Escherichia coli (strain K12) GN=recQ PE=1 SV=5 6 456 3.0E-82
sp|P40724|RECQ_SALTY ATP-dependent DNA helicase RecQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=recQ PE=3 SV=3 6 442 3.0E-82
sp|Q9CL21|RECQ_PASMU ATP-dependent DNA helicase RecQ OS=Pasteurella multocida (strain Pm70) GN=recQ PE=3 SV=1 10 442 6.0E-82
sp|Q6AYJ1|RECQ1_RAT ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=1 SV=1 4 513 5.0E-81
sp|Q9FT73|MED34_ARATH Mediator of RNA polymerase II transcription subunit 34 OS=Arabidopsis thaliana GN=MED34 PE=1 SV=1 15 450 2.0E-80
sp|P71359|RECQ_HAEIN ATP-dependent DNA helicase RecQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=recQ PE=3 SV=1 10 442 7.0E-80
sp|Q9FT74|RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana GN=RECQL1 PE=2 SV=1 3 424 5.0E-78
sp|Q9TXJ8|RECQ1_CAEEL Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis elegans GN=K02F3.12 PE=3 SV=3 11 443 6.0E-77
sp|Q19546|WRN_CAEEL Probable Werner syndrome ATP-dependent helicase homolog 1 OS=Caenorhabditis elegans GN=wrn-1 PE=3 SV=2 1 442 1.0E-69
sp|O34748|RECQ_BACSU Probable ATP-dependent DNA helicase RecQ OS=Bacillus subtilis (strain 168) GN=recQ PE=3 SV=1 5 456 3.0E-65
sp|Q5UPX0|YR290_MIMIV Putative ATP-dependent RNA helicase R290 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R290 PE=3 SV=1 15 443 1.0E-64
sp|P50729|RECS_BACSU Probable ATP-dependent DNA helicase RecS OS=Bacillus subtilis (strain 168) GN=recS PE=3 SV=1 5 358 6.0E-61
sp|P73421|RECQ_SYNY3 ATP-dependent DNA helicase RecQ OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=recQ PE=3 SV=1 9 361 2.0E-56
sp|O93530|WRN_XENLA Werner syndrome ATP-dependent helicase homolog OS=Xenopus laevis GN=wrn PE=2 SV=1 1 443 8.0E-56
sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2 12 364 1.0E-51
sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 10 364 5.0E-50
sp|Q0WVW7|RQL5_ARATH ATP-dependent DNA helicase Q-like 5 OS=Arabidopsis thaliana GN=RECQL5 PE=2 SV=2 11 369 6.0E-46
sp|O94761|RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens GN=RECQL4 PE=1 SV=1 16 359 2.0E-39
sp|Q75NR7|RECQ4_MOUSE ATP-dependent DNA helicase Q4 OS=Mus musculus GN=Recql4 PE=2 SV=2 16 359 2.0E-36
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 10 223 9.0E-32
sp|P0CT33|TLH1_SCHPO ATP-dependent DNA helicase tlh1 (Fragment) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh1 PE=3 SV=1 26 383 3.0E-27
sp|Q1RKN3|TLH2_SCHPO ATP-dependent DNA helicase tlh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tlh2 PE=2 SV=1 26 383 4.0E-27
sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 254 442 2.0E-22
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 17 385 4.0E-16
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 17 385 4.0E-16
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 9 357 6.0E-16
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 9 357 6.0E-16
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 16 372 6.0E-15
sp|Q0E2Z7|RH41_ORYSJ DEAD-box ATP-dependent RNA helicase 41 OS=Oryza sativa subsp. japonica GN=Os02g0201900 PE=2 SV=2 25 376 9.0E-15
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 10 363 9.0E-15
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 25 359 9.0E-15
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 25 361 1.0E-14
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 16 457 2.0E-14
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 25 359 2.0E-14
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 25 361 2.0E-14
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 25 361 3.0E-14
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 25 361 3.0E-14
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 25 361 3.0E-14
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 25 361 3.0E-14
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 25 361 3.0E-14
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 25 361 3.0E-14
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 25 361 3.0E-14
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 25 361 3.0E-14
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 32 365 3.0E-14
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 16 381 3.0E-14
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 16 381 4.0E-14
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 16 381 4.0E-14
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 16 381 4.0E-14
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 16 381 5.0E-14
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 25 359 6.0E-14
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 25 359 7.0E-14
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 25 359 7.0E-14
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 25 359 7.0E-14
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 25 359 7.0E-14
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 25 361 7.0E-14
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 17 365 2.0E-13
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 17 365 2.0E-13
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 25 469 2.0E-13
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 32 372 2.0E-13
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 32 372 3.0E-13
sp|P47664|Y425_MYCGE Probable ATP-dependent RNA helicase MG425 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG425 PE=3 SV=1 25 380 3.0E-13
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 16 359 5.0E-13
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 25 359 5.0E-13
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 4 364 6.0E-13
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 32 372 6.0E-13
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 16 361 8.0E-13
sp|A3GHW9|ROK1_PICST ATP-dependent RNA helicase ROK1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ROK1 PE=3 SV=1 32 386 9.0E-13
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 32 365 2.0E-12
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 25 415 2.0E-12
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 14 372 2.0E-12
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 14 372 2.0E-12
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 25 359 3.0E-12
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 17 401 3.0E-12
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 23 372 4.0E-12
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 17 370 5.0E-12
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 16 411 6.0E-12
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 9 453 6.0E-12
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 33 427 8.0E-12
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 17 365 9.0E-12
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 17 364 9.0E-12
sp|Q6BP45|ROK1_DEBHA ATP-dependent RNA helicase ROK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROK1 PE=3 SV=2 17 386 1.0E-11
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 32 373 1.0E-11
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 25 367 1.0E-11
sp|Q2GUI4|DBP3_CHAGB ATP-dependent RNA helicase DBP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP3 PE=3 SV=1 32 364 1.0E-11
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 16 361 1.0E-11
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 32 361 1.0E-11
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 1 372 2.0E-11
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 3 382 2.0E-11
sp|P75172|Y623_MYCPN Probable ATP-dependent RNA helicase MG425 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_623 PE=3 SV=1 25 372 2.0E-11
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 33 364 2.0E-11
sp|Q9Y7C4|ROK1_CANAL ATP-dependent RNA helicase CHR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHR1 PE=3 SV=1 25 384 2.0E-11
sp|Q6CT49|PRP28_KLULA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP28 PE=3 SV=1 10 364 2.0E-11
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 32 364 2.0E-11
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 33 420 2.0E-11
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 29 352 3.0E-11
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 23 372 3.0E-11
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 16 365 3.0E-11
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 25 370 3.0E-11
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 32 373 3.0E-11
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 32 373 3.0E-11
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 32 373 3.0E-11
sp|Q9DBN9|DDX59_MOUSE Probable ATP-dependent RNA helicase DDX59 OS=Mus musculus GN=Ddx59 PE=1 SV=1 25 359 3.0E-11
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 32 370 4.0E-11
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 25 427 4.0E-11
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 32 372 4.0E-11
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 32 372 5.0E-11
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 32 373 5.0E-11
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 32 405 5.0E-11
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 32 372 5.0E-11
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 25 373 5.0E-11
sp|A5DIX5|ROK1_PICGU ATP-dependent RNA helicase ROK1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ROK1 PE=3 SV=2 4 384 6.0E-11
sp|Q5T1V6|DDX59_HUMAN Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens GN=DDX59 PE=1 SV=1 25 361 6.0E-11
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 35 372 7.0E-11
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 32 373 7.0E-11
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 25 364 7.0E-11
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 25 370 9.0E-11
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 17 364 1.0E-10
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 32 364 1.0E-10
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 25 364 1.0E-10
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 9 365 1.0E-10
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 32 361 1.0E-10
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 25 361 1.0E-10
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 25 361 1.0E-10
sp|Q755W0|FAL1_ASHGO ATP-dependent RNA helicase FAL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FAL1 PE=3 SV=2 9 369 1.0E-10
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 240 352 1.0E-10
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 16 429 1.0E-10
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 32 361 1.0E-10
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 25 364 2.0E-10
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 16 364 2.0E-10
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 25 363 2.0E-10
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 25 363 2.0E-10
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 32 372 2.0E-10
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 25 372 2.0E-10
sp|Q6FY67|MAK5_CANGA ATP-dependent RNA helicase MAK5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MAK5 PE=3 SV=1 5 367 2.0E-10
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 3 453 3.0E-10
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 23 364 3.0E-10
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 8 361 3.0E-10
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 25 372 3.0E-10
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 253 383 3.0E-10
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 25 365 3.0E-10
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 25 364 3.0E-10
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 17 349 4.0E-10
sp|A1CH78|DED1_ASPCL ATP-dependent RNA helicase ded1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ded1 PE=3 SV=1 25 372 4.0E-10
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 250 357 4.0E-10
sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 33 351 4.0E-10
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 25 370 4.0E-10
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 25 372 4.0E-10
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 32 361 4.0E-10
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 25 365 6.0E-10
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 11 365 6.0E-10
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 32 365 6.0E-10
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 16 392 6.0E-10
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 240 352 6.0E-10
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 33 430 6.0E-10
sp|O13792|SUB2_SCHPO ATP-dependent RNA helicase uap56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap56 PE=1 SV=3 25 383 7.0E-10
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 33 427 7.0E-10
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 32 365 7.0E-10
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 33 427 7.0E-10
sp|Q4I7F9|PRP28_GIBZE Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP28 PE=3 SV=1 25 364 8.0E-10
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 33 364 8.0E-10
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 25 382 9.0E-10
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 25 362 9.0E-10
sp|P21507|SRMB_ECOLI ATP-dependent RNA helicase SrmB OS=Escherichia coli (strain K12) GN=srmB PE=1 SV=1 35 366 9.0E-10
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 33 364 9.0E-10
sp|A5DPU0|MAK5_PICGU ATP-dependent RNA helicase MAK5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MAK5 PE=3 SV=1 17 367 1.0E-09
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 23 372 1.0E-09
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 9 362 1.0E-09
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 32 366 1.0E-09
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 25 382 1.0E-09
sp|A5DU73|PRP28_LODEL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP28 PE=3 SV=1 14 365 1.0E-09
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 25 361 1.0E-09
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 25 372 1.0E-09
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 25 376 1.0E-09
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 17 369 2.0E-09
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 33 430 2.0E-09
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 32 365 2.0E-09
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 25 372 2.0E-09
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 25 372 2.0E-09
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 25 361 2.0E-09
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 25 372 2.0E-09
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 33 430 2.0E-09
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 32 372 2.0E-09
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 254 349 2.0E-09
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 25 361 2.0E-09
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 17 365 2.0E-09
sp|Q0TXZ2|SUB2_PHANO ATP-dependent RNA helicase SUB2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SUB2 PE=3 SV=1 25 388 2.0E-09
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 32 372 2.0E-09
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 25 364 3.0E-09
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 10 364 3.0E-09
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 16 414 3.0E-09
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 9 364 3.0E-09
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 25 364 3.0E-09
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 25 372 3.0E-09
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 9 370 4.0E-09
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 25 364 4.0E-09
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 25 364 4.0E-09
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 25 361 4.0E-09
sp|Q66HG7|DDX59_RAT Probable ATP-dependent RNA helicase DDX59 OS=Rattus norvegicus GN=Ddx59 PE=2 SV=1 25 359 5.0E-09
sp|Q3EBD3|RH41_ARATH DEAD-box ATP-dependent RNA helicase 41 OS=Arabidopsis thaliana GN=RH41 PE=2 SV=1 25 364 5.0E-09
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 25 370 6.0E-09
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 17 365 6.0E-09
sp|Q12099|FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAL1 PE=1 SV=1 25 370 6.0E-09
sp|A6ZXY5|FAL1_YEAS7 ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FAL1 PE=3 SV=1 25 370 6.0E-09
sp|Q0CLJ6|DED1_ASPTN ATP-dependent RNA helicase ded1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ded1 PE=3 SV=1 25 372 7.0E-09
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 25 424 7.0E-09
sp|Q59W52|PRP28_CANAL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP28 PE=3 SV=1 16 365 7.0E-09
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 16 363 8.0E-09
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 254 369 8.0E-09
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 254 369 8.0E-09
sp|Q5APT8|DBP3_CANAL ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1 33 427 9.0E-09
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 10 414 1.0E-08
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 23 372 1.0E-08
sp|Q6BME5|SUB2_DEBHA ATP-dependent RNA helicase SUB2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUB2 PE=3 SV=2 25 374 1.0E-08
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 25 365 1.0E-08
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 25 372 1.0E-08
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 17 365 1.0E-08
sp|P54475|CSHB_BACSU DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus subtilis (strain 168) GN=cshB PE=1 SV=1 25 366 1.0E-08
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 25 414 1.0E-08
sp|A3GFV3|FAL1_PICST ATP-dependent RNA helicase FAL1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FAL1 PE=3 SV=1 251 382 2.0E-08
sp|A7EIX7|SUB2_SCLS1 ATP-dependent RNA helicase sub2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sub2 PE=3 SV=1 25 363 2.0E-08
sp|A3AVH5|RH13_ORYSJ DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. japonica GN=Os04g0510400 PE=2 SV=2 31 364 2.0E-08
sp|A2XVF7|RH13_ORYSI DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. indica GN=OsI_016050 PE=3 SV=2 31 364 2.0E-08
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 25 372 2.0E-08
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 35 361 2.0E-08
sp|Q8Y755|CSHB_LISMO DEAD-box ATP-dependent RNA helicase CshB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshB PE=2 SV=1 25 364 2.0E-08
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 254 365 2.0E-08
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 17 363 2.0E-08
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 25 370 3.0E-08
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 25 414 3.0E-08
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 250 381 3.0E-08
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 250 381 3.0E-08
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 25 372 3.0E-08
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 32 364 3.0E-08
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 230 364 3.0E-08
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 17 365 3.0E-08
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 17 364 3.0E-08
sp|A7EAY2|MAK5_SCLS1 ATP-dependent RNA helicase mak5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mak5 PE=3 SV=1 25 372 3.0E-08
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 25 382 4.0E-08
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 25 364 4.0E-08
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 25 414 4.0E-08
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 240 351 4.0E-08
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 10 382 4.0E-08
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 240 351 4.0E-08
sp|Q0CLX0|PRP28_ASPTN Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp28 PE=3 SV=1 254 365 4.0E-08
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 251 364 4.0E-08
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 251 364 4.0E-08
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 5 370 4.0E-08
sp|Q7S5R1|DBP3_NEUCR ATP-dependent RNA helicase dbp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-3 PE=3 SV=1 224 364 4.0E-08
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 25 373 4.0E-08
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 14 363 5.0E-08
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 25 364 5.0E-08
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 32 380 5.0E-08
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 4 361 5.0E-08
sp|A2R0B5|SUB2_ASPNC ATP-dependent RNA helicase sub2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sub2 PE=3 SV=1 25 364 5.0E-08
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 25 376 5.0E-08
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 17 363 5.0E-08
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 254 365 5.0E-08
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 25 364 5.0E-08
sp|Q6GWX0|DDX4_PIG Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa GN=DDX4 PE=2 SV=1 17 363 6.0E-08
sp|A1CMQ7|SUB2_ASPCL ATP-dependent RNA helicase sub2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sub2 PE=3 SV=1 25 364 6.0E-08
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 25 364 6.0E-08
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 25 364 6.0E-08
sp|Q1DI07|SUB2_COCIM ATP-dependent RNA helicase SUB2 OS=Coccidioides immitis (strain RS) GN=SUB2 PE=3 SV=1 254 383 7.0E-08
sp|Q9CJS1|RHLB_PASMU ATP-dependent RNA helicase RhlB OS=Pasteurella multocida (strain Pm70) GN=rhlB PE=3 SV=1 32 377 7.0E-08
sp|Q2FY15|CSHB_STAA8 DEAD-box ATP-dependent RNA helicase CshB OS=Staphylococcus aureus (strain NCTC 8325) GN=cshB PE=3 SV=1 44 368 7.0E-08
sp|Q0CGJ9|SUB2_ASPTN ATP-dependent RNA helicase sub2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sub2 PE=3 SV=1 254 364 8.0E-08
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 25 372 8.0E-08
sp|C4LB49|RHLB_TOLAT ATP-dependent RNA helicase RhlB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rhlB PE=3 SV=1 250 370 9.0E-08
sp|B1KQF6|RHLB_SHEWM ATP-dependent RNA helicase RhlB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rhlB PE=3 SV=1 146 377 9.0E-08
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 25 380 1.0E-07
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 25 380 1.0E-07
sp|Q0JM17|RH56_ORYSJ DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sativa subsp. japonica GN=Os01g0549700 PE=2 SV=2 25 361 1.0E-07
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 16 370 1.0E-07
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 254 365 1.0E-07
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 254 365 1.0E-07
sp|Q4WCW2|SUB2_ASPFU ATP-dependent RNA helicase sub2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sub2 PE=3 SV=1 25 364 1.0E-07
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 254 364 1.0E-07
sp|A8GZJ0|RHLB_SHEPA ATP-dependent RNA helicase RhlB OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rhlB PE=3 SV=1 146 368 1.0E-07
sp|Q5JK84|RH15_ORYSJ DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sativa subsp. japonica GN=Os01g0550000 PE=2 SV=1 25 361 1.0E-07
sp|A7TLA0|SUB21_VANPO ATP-dependent RNA helicase SUB2-1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-1 PE=3 SV=1 25 371 1.0E-07
sp|A7TJT7|SUB22_VANPO ATP-dependent RNA helicase SUB2-2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-2 PE=3 SV=1 25 371 1.0E-07
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 25 352 1.0E-07
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 254 376 1.0E-07
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 9 370 1.0E-07
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 254 365 1.0E-07
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 25 374 1.0E-07
sp|Q6FJG1|FAL1_CANGA ATP-dependent RNA helicase FAL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FAL1 PE=3 SV=1 25 370 1.0E-07
sp|Q26696|DDX17_TRYBB Putative DEAD-box RNA helicase HEL64 OS=Trypanosoma brucei brucei GN=HEL64 PE=3 SV=1 33 378 1.0E-07
sp|A4RN46|PRP5_MAGO7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP5 PE=3 SV=1 25 375 2.0E-07
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 250 370 2.0E-07
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 3 370 2.0E-07
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 25 372 2.0E-07
sp|Q4WH83|DBP3_ASPFU ATP-dependent RNA helicase dbp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp3 PE=3 SV=1 33 430 2.0E-07
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 254 372 2.0E-07
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 3 370 2.0E-07
sp|B0TJ29|RHLB_SHEHH ATP-dependent RNA helicase RhlB OS=Shewanella halifaxensis (strain HAW-EB4) GN=rhlB PE=3 SV=1 250 368 2.0E-07
sp|A0KEG9|RHLB_AERHH ATP-dependent RNA helicase RhlB OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rhlB PE=3 SV=1 250 357 2.0E-07
sp|Q15N18|RHLB_PSEA6 ATP-dependent RNA helicase RhlB OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rhlB PE=3 SV=1 250 368 2.0E-07
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 215 364 2.0E-07
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 224 365 2.0E-07
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 215 364 2.0E-07
sp|Q5AUL4|FAL1_EMENI ATP-dependent RNA helicase fal1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fal1 PE=3 SV=1 9 370 2.0E-07
sp|Q2U6P7|SUB2_ASPOR ATP-dependent RNA helicase sub2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sub2 PE=3 SV=1 254 364 2.0E-07
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 16 363 2.0E-07
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 251 370 2.0E-07
sp|Q2NQB2|RHLB_SODGM ATP-dependent RNA helicase RhlB OS=Sodalis glossinidius (strain morsitans) GN=rhlB PE=3 SV=1 25 368 2.0E-07
sp|Q5A9Z6|FAL1_CANAL ATP-dependent RNA helicase FAL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FAL1 PE=3 SV=1 251 370 3.0E-07
sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 251 370 3.0E-07
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 246 365 3.0E-07
sp|A4STJ7|RHLB_AERS4 ATP-dependent RNA helicase RhlB OS=Aeromonas salmonicida (strain A449) GN=rhlB PE=3 SV=1 250 357 3.0E-07
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 251 370 3.0E-07
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 251 370 3.0E-07
sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 253 370 3.0E-07
sp|A1DL85|SUB2_NEOFI ATP-dependent RNA helicase sub2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sub2 PE=3 SV=1 254 364 3.0E-07
sp|B8CHZ1|RHLB_SHEPW ATP-dependent RNA helicase RhlB OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rhlB PE=3 SV=1 250 368 3.0E-07
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 251 370 3.0E-07
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 251 370 3.0E-07
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 251 370 3.0E-07
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 251 370 3.0E-07
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 251 370 3.0E-07
sp|Q5U216|DX39A_RAT ATP-dependent RNA helicase DDX39A OS=Rattus norvegicus GN=Ddx39a PE=2 SV=1 25 364 3.0E-07
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 251 370 3.0E-07
sp|Q6CXT4|IF4A_KLULA ATP-dependent RNA helicase eIF4A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIF1 PE=3 SV=1 9 370 3.0E-07
sp|Q61496|DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4 OS=Mus musculus GN=Ddx4 PE=1 SV=2 17 360 3.0E-07
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 251 370 3.0E-07
sp|Q8VDW0|DX39A_MOUSE ATP-dependent RNA helicase DDX39A OS=Mus musculus GN=Ddx39a PE=1 SV=1 25 364 3.0E-07
sp|Q4WEB4|FAL1_ASPFU ATP-dependent RNA helicase fal1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fal1 PE=3 SV=2 251 370 4.0E-07
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 17 363 4.0E-07
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 16 414 4.0E-07
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 223 361 4.0E-07
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 251 370 4.0E-07
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 251 370 4.0E-07
sp|Q6CT46|DBP3_KLULA ATP-dependent RNA helicase DBP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP3 PE=3 SV=1 33 427 4.0E-07
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 34 363 4.0E-07
sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens GN=DDX39A PE=1 SV=2 25 364 4.0E-07
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 17 363 5.0E-07
sp|Q6CM95|SUB2_KLULA ATP-dependent RNA helicase SUB2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUB2 PE=3 SV=1 25 364 5.0E-07
sp|A6R603|SUB2_AJECN ATP-dependent RNA helicase SUB2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SUB2 PE=3 SV=2 254 363 5.0E-07
sp|P10081|IF4A_YEAST ATP-dependent RNA helicase eIF4A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF1 PE=1 SV=3 9 370 6.0E-07
sp|A6ZQJ1|IF4A_YEAS7 ATP-dependent RNA helicase eIF4A OS=Saccharomyces cerevisiae (strain YJM789) GN=TIF1 PE=3 SV=1 9 370 6.0E-07
sp|Q7MYL2|RHLB_PHOLL ATP-dependent RNA helicase RhlB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rhlB PE=3 SV=1 33 395 6.0E-07
sp|Q6BT27|FAL1_DEBHA ATP-dependent RNA helicase FAL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FAL1 PE=3 SV=1 251 370 6.0E-07
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 215 369 6.0E-07
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 215 395 7.0E-07
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 215 395 7.0E-07
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 16 357 7.0E-07
sp|Q0UAT0|FAL1_PHANO ATP-dependent RNA helicase FAL1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FAL1 PE=3 SV=3 251 370 7.0E-07
sp|Q6CH90|SUB2_YARLI ATP-dependent RNA helicase SUB2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUB2 PE=3 SV=2 25 371 7.0E-07
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 4 361 7.0E-07
sp|A5DWJ1|FAL1_LODEL ATP-dependent RNA helicase FAL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FAL1 PE=3 SV=1 251 382 8.0E-07
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 254 364 8.0E-07
sp|A1SAL1|RHLB_SHEAM ATP-dependent RNA helicase RhlB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rhlB PE=3 SV=1 146 368 8.0E-07
sp|Q10I26|RH34_ORYSJ DEAD-box ATP-dependent RNA helicase 34 OS=Oryza sativa subsp. japonica GN=Os03g0566800 PE=2 SV=1 251 370 8.0E-07
sp|Q5VNM3|RH2_ORYSJ DEAD-box ATP-dependent RNA helicase 2 OS=Oryza sativa subsp. japonica GN=Os01g0639100 PE=2 SV=1 251 370 8.0E-07
sp|Q84TG1|RH57_ARATH DEAD-box ATP-dependent RNA helicase 57 OS=Arabidopsis thaliana GN=RH57 PE=2 SV=1 254 374 8.0E-07
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 34 430 9.0E-07
sp|B0UUZ9|RHLB_HISS2 ATP-dependent RNA helicase RhlB OS=Histophilus somni (strain 2336) GN=rhlB PE=3 SV=1 250 377 9.0E-07
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 251 370 1.0E-06
sp|Q65RG7|RHLB_MANSM ATP-dependent RNA helicase RhlB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rhlB PE=3 SV=1 32 368 1.0E-06
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 35 364 1.0E-06
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 14 398 1.0E-06
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 4 361 1.0E-06
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 4 361 1.0E-06
sp|Q9C8S9|RH48_ARATH Probable DEAD-box ATP-dependent RNA helicase 48 OS=Arabidopsis thaliana GN=RH48 PE=3 SV=1 25 361 1.0E-06
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 4 361 1.0E-06
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 215 364 1.0E-06
sp|A3Q9R3|RHLB_SHELP ATP-dependent RNA helicase RhlB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rhlB PE=3 SV=1 142 368 1.0E-06
sp|Q0I1X0|RHLB_HAES1 ATP-dependent RNA helicase RhlB OS=Haemophilus somnus (strain 129Pt) GN=rhlB PE=3 SV=1 250 377 1.0E-06
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 251 370 1.0E-06
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 251 370 1.0E-06
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 251 370 1.0E-06
sp|P0CR05|ROK1_CRYNB ATP-dependent RNA helicase ROK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ROK1 PE=3 SV=1 225 369 1.0E-06
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 251 370 1.0E-06
sp|A6VKC3|RHLB_ACTSZ ATP-dependent RNA helicase RhlB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rhlB PE=3 SV=1 33 368 1.0E-06
sp|P0CR04|ROK1_CRYNJ ATP-dependent RNA helicase ROK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ROK1 PE=3 SV=1 225 369 1.0E-06
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 251 370 1.0E-06
sp|Q6YS30|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1 35 364 1.0E-06
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 251 370 1.0E-06
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 251 370 1.0E-06
sp|A7TEF4|FAL1_VANPO ATP-dependent RNA helicase FAL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FAL1 PE=3 SV=1 3 370 1.0E-06
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 251 370 2.0E-06
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 251 370 2.0E-06
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 251 370 2.0E-06
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 251 370 2.0E-06
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 251 370 2.0E-06
sp|A3LST5|SUB2_PICST ATP-dependent RNA helicase SUB2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SUB2 PE=3 SV=1 25 364 2.0E-06
sp|A5DE68|FAL1_PICGU ATP-dependent RNA helicase FAL1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FAL1 PE=3 SV=2 251 364 2.0E-06
sp|A3LQW7|DBP2_PICST ATP-dependent RNA helicase DBP2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP2 PE=3 SV=1 32 340 2.0E-06
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 25 364 2.0E-06
sp|A5E1N2|ROK1_LODEL ATP-dependent RNA helicase ROK1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ROK1 PE=3 SV=1 25 384 2.0E-06
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 25 361 2.0E-06
sp|P41380|IF4A3_NICPL Eukaryotic initiation factor 4A-3 OS=Nicotiana plumbaginifolia PE=2 SV=1 251 370 2.0E-06
sp|Q94A52|RH2_ARATH DEAD-box ATP-dependent RNA helicase 2 OS=Arabidopsis thaliana GN=RH2 PE=2 SV=2 251 370 2.0E-06
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 254 369 2.0E-06
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 254 362 2.0E-06
sp|A1RFB3|RHLB_SHESW ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain W3-18-1) GN=rhlB PE=3 SV=1 250 368 2.0E-06
sp|A4YB09|RHLB_SHEPC ATP-dependent RNA helicase RhlB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rhlB PE=3 SV=1 250 368 2.0E-06
sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 254 364 2.0E-06
sp|P38112|MAK5_YEAST ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK5 PE=1 SV=1 250 367 2.0E-06
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 254 364 2.0E-06
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 251 370 2.0E-06
sp|A9L5D5|RHLB_SHEB9 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS195) GN=rhlB PE=3 SV=1 250 368 3.0E-06
sp|A6WTD3|RHLB_SHEB8 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS185) GN=rhlB PE=3 SV=1 250 368 3.0E-06
sp|A3D9I5|RHLB_SHEB5 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rhlB PE=3 SV=1 250 368 3.0E-06
sp|B8E670|RHLB_SHEB2 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS223) GN=rhlB PE=3 SV=1 250 368 3.0E-06
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 215 361 3.0E-06
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 254 368 3.0E-06
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 254 364 3.0E-06
sp|Q6CZD9|RHLB_PECAS ATP-dependent RNA helicase RhlB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rhlB PE=3 SV=3 250 368 4.0E-06
sp|A5DDN0|SUB2_PICGU ATP-dependent RNA helicase SUB2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SUB2 PE=3 SV=3 25 364 4.0E-06
sp|A5UDI1|RHLB_HAEIE ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain PittEE) GN=rhlB PE=3 SV=1 250 377 4.0E-06
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 251 370 4.0E-06
sp|A5UI36|RHLB_HAEIG ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain PittGG) GN=rhlB PE=3 SV=1 250 377 4.0E-06
sp|A1SZG4|RHLB_PSYIN ATP-dependent RNA helicase RhlB OS=Psychromonas ingrahamii (strain 37) GN=rhlB PE=3 SV=1 250 359 4.0E-06
sp|Q8EJQ5|RHLB_SHEON ATP-dependent RNA helicase RhlB OS=Shewanella oneidensis (strain MR-1) GN=rhlB PE=3 SV=1 146 368 5.0E-06
sp|Q0HQL1|RHLB_SHESR ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-7) GN=rhlB PE=3 SV=1 250 368 5.0E-06
sp|Q0HN76|RHLB_SHESM ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-4) GN=rhlB PE=3 SV=1 250 368 5.0E-06
sp|P44922|RHLB_HAEIN ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rhlB PE=3 SV=2 250 377 5.0E-06
sp|Q40469|IF4A6_TOBAC Eukaryotic initiation factor 4A-6 (Fragment) OS=Nicotiana tabacum PE=2 SV=1 251 364 5.0E-06
sp|A0KS84|RHLB_SHESA ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain ANA-3) GN=rhlB PE=3 SV=1 250 368 5.0E-06
sp|A4RBS3|SUB2_MAGO7 ATP-dependent RNA helicase SUB2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SUB2 PE=3 SV=1 254 383 5.0E-06
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 254 351 5.0E-06
sp|Q4PDT1|DBP3_USTMA ATP-dependent RNA helicase DBP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP3 PE=3 SV=1 36 364 5.0E-06
sp|A6ZL85|MAK5_YEAS7 ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain YJM789) GN=MAK5 PE=3 SV=1 250 367 6.0E-06
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 25 372 6.0E-06
sp|Q07478|SUB2_YEAST ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUB2 PE=1 SV=1 25 364 7.0E-06
sp|A6ZXP4|SUB2_YEAS7 ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain YJM789) GN=SUB2 PE=3 SV=1 25 364 7.0E-06
sp|Q6FL17|SUB2_CANGA ATP-dependent RNA helicase SUB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SUB2 PE=3 SV=1 25 364 7.0E-06
sp|A8G0U0|RHLB_SHESH ATP-dependent RNA helicase RhlB OS=Shewanella sediminis (strain HAW-EB3) GN=rhlB PE=3 SV=1 146 368 7.0E-06
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 25 424 8.0E-06
sp|G2TRN7|YM06_SCHPO RecQ DNA helicase-like protein C212.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC212.06c PE=3 SV=1 325 382 8.0E-06
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 254 351 8.0E-06
sp|B4F1V3|RHLB_PROMH ATP-dependent RNA helicase RhlB OS=Proteus mirabilis (strain HI4320) GN=rhlB PE=3 SV=1 250 368 8.0E-06
sp|P41378|IF4A_WHEAT Eukaryotic initiation factor 4A OS=Triticum aestivum PE=2 SV=1 251 364 8.0E-06
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 266 363 8.0E-06
sp|Q2H4D0|SUB2_CHAGB ATP-dependent RNA helicase SUB2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SUB2 PE=3 SV=1 254 359 8.0E-06
sp|Q4PEX7|DBP8_USTMA ATP-dependent RNA helicase DBP8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP8 PE=3 SV=2 250 364 9.0E-06
sp|Q6K7R9|RH48_ORYSJ DEAD-box ATP-dependent RNA helicase 48 OS=Oryza sativa subsp. japonica GN=Os02g0826100 PE=2 SV=1 17 361 9.0E-06
sp|A2QEN5|IF4A_ASPNC ATP-dependent RNA helicase eIF4A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tif1 PE=3 SV=1 16 370 9.0E-06
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 240 349 9.0E-06
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 25 372 9.0E-06
sp|C6DHF5|RHLB_PECCP ATP-dependent RNA helicase RhlB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhlB PE=3 SV=1 25 368 1.0E-05
sp|Q6Z2Z4|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica GN=Os02g0146600 PE=2 SV=1 251 364 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0017076 purine nucleotide binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0043167 ion binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|104310
MQQPLNGYENVLKRVFGHTEFRGKQQDVIEAAIAGRDVFVLAPTGMGKSLCFQLPAVTAETGVTLVISPLCALMV
NQVEKLRAKGIAVVAWNSDTDIEERQTFEKDLLSASPQTRLLYISPERYATSNCIRLLDSIYKKRRLNRFVIDEA
HCISEWGHSFRSDYRGLGKFRDRYSDVPIMALTATATPVVQRDILYSLKIDKNDVFYAVHPFNRENLFYEVRYMS
LLDSQTRKQHIFDYINLLHQRRKRPSSGIIYCRAKATCDDVSDFLRRNGLNAQSYHSGISQGVLKQTLKKWSAGG
NGGQKTIDVVVATIAFGLGIDKDDVRYVIHYDLPTSFEGYYQETGRAGRDGQPSKCILYYSREDALGIRERVTTS
KPNRINDGFQGPSPTQRAKSSIDELIQYAENVATCRHIGICRYFGEDVDESKPDTVESLCDSMCDVCKYSDKTKK
RITVLTPRDEVQIFRRQRQRPCQETSENLPEANKVIPFPVNGGIDTGENKRRNDAADPPGPPRATKKVKTGHISI
LKTLPFRSINRLKKPFKSPLLTKDVNSHISNSRSVILSESGGSDFTAEVQGEPDIETGSGMEEYTDSALGVEANE
RDYCQKKLDSVPEDELESQFFATDVELENSISTKLPLPHRMKGFATIRRSMCSLKRRALRDLAHFNPNIDQWEKI
LQDSAREAEFAALSLSSTSNGYNILIRRTARAVSHLANPEHGQDEDVLGDAQDMMDIIRRHCEIWQNKAIQGV*
Coding >Agabi119p4|104310
ATGCAACAACCTTTGAATGGTTACGAGAATGTACTCAAGAGAGTGTTCGGGCATACAGAATTCAGAGGGAAACAA
CAGGATGTGATAGAGGCTGCCATTGCTGGGCGCGATGTTTTTGTATTGGCTCCAACCGGAATGGGAAAGAGTTTG
TGTTTCCAGTTGCCAGCTGTGACCGCGGAAACGGGAGTAACTTTAGTAATATCTCCCCTTTGTGCATTGATGGTT
AATCAGGTTGAGAAATTGCGGGCAAAAGGTATTGCAGTGGTCGCTTGGAATTCTGATACCGACATCGAGGAGCGA
CAGACCTTTGAGAAGGACCTCCTTTCTGCAAGCCCGCAGACTCGCCTACTGTATATTTCTCCAGAAAGATACGCG
ACTTCCAATTGCATTCGTTTGTTAGACAGCATTTACAAGAAGCGTAGGCTCAATCGCTTTGTTATTGACGAAGCA
CATTGCATTTCAGAGTGGGGACACAGTTTTCGTAGTGATTATCGTGGCCTTGGAAAATTTCGAGATCGTTATAGT
GACGTTCCAATCATGGCTTTGACTGCCACTGCTACTCCGGTTGTCCAGAGGGATATTTTATATAGTTTGAAGATT
GACAAGAACGACGTGTTTTATGCCGTTCATCCGTTTAACCGGGAGAATCTATTCTACGAGGTCAGATACATGTCA
TTGTTGGATTCGCAGACCAGAAAACAACACATCTTCGATTATATCAACTTACTCCATCAGCGAAGGAAAAGACCA
TCCTCCGGGATCATCTACTGTCGCGCCAAGGCTACGTGCGACGATGTTTCTGATTTTCTTCGGCGAAATGGGCTG
AATGCACAGTCATACCATAGTGGAATTAGTCAGGGAGTCCTTAAGCAGACGCTCAAAAAGTGGTCTGCTGGCGGA
AATGGTGGCCAAAAGACCATTGATGTGGTCGTTGCTACTATTGCTTTCGGCCTCGGAATTGACAAGGACGACGTC
AGATATGTAATCCATTATGATCTTCCTACAAGTTTTGAAGGCTATTACCAAGAGACAGGCAGAGCAGGCAGAGAT
GGACAGCCTTCAAAATGCATCCTATATTATTCCAGGGAAGATGCTCTTGGAATCCGGGAGCGCGTTACAACATCC
AAACCAAATCGTATAAATGATGGTTTTCAAGGCCCATCTCCGACACAGAGAGCCAAGAGTAGCATAGATGAGTTG
ATTCAATACGCGGAAAATGTTGCAACCTGCCGGCATATAGGCATCTGTCGTTATTTTGGAGAAGATGTAGACGAG
AGTAAACCCGACACGGTTGAAAGCTTGTGCGATTCAATGTGTGATGTTTGCAAATACTCAGACAAGACGAAGAAA
CGCATTACTGTCCTCACGCCGCGAGACGAGGTTCAAATTTTCCGTCGACAACGGCAGCGTCCATGTCAAGAAACC
TCGGAGAACCTCCCGGAGGCAAATAAGGTGATACCTTTCCCAGTGAATGGGGGAATTGATACGGGAGAGAATAAA
CGGAGAAATGACGCTGCCGATCCTCCTGGTCCGCCGCGAGCTACCAAGAAAGTCAAGACCGGTCATATCTCCATC
CTAAAAACGCTTCCTTTCCGGTCTATCAATCGATTGAAAAAACCGTTCAAATCACCTCTTTTGACAAAGGACGTA
AATTCTCATATTTCAAACTCTCGATCCGTTATTCTATCCGAAAGTGGCGGTAGCGATTTTACGGCTGAAGTACAG
GGGGAACCAGACATCGAAACAGGCAGCGGCATGGAGGAATATACGGACAGCGCCCTTGGTGTAGAAGCCAATGAG
AGAGACTACTGTCAGAAAAAGCTAGATTCAGTTCCCGAAGACGAGCTTGAATCTCAATTCTTCGCCACCGACGTG
GAGCTAGAGAACTCCATTTCCACCAAGTTGCCATTGCCTCATCGGATGAAGGGATTCGCTACAATCCGAAGATCG
ATGTGTTCACTCAAGAGGAGAGCTTTACGCGACCTTGCTCATTTCAACCCAAATATAGACCAGTGGGAAAAGATC
TTGCAAGATTCAGCGCGGGAGGCGGAGTTTGCTGCTCTATCACTATCTAGCACCTCGAACGGATACAATATTCTA
ATACGAAGGACGGCTCGAGCAGTCTCTCATTTAGCCAACCCGGAACATGGACAAGATGAGGACGTCCTCGGCGAC
GCACAGGATATGATGGATATCATTCGGCGACACTGTGAAATTTGGCAGAATAAAGCAATCCAAGGAGTATGA
Transcript >Agabi119p4|104310
ATGCAACAACCTTTGAATGGTTACGAGAATGTACTCAAGAGAGTGTTCGGGCATACAGAATTCAGAGGGAAACAA
CAGGATGTGATAGAGGCTGCCATTGCTGGGCGCGATGTTTTTGTATTGGCTCCAACCGGAATGGGAAAGAGTTTG
TGTTTCCAGTTGCCAGCTGTGACCGCGGAAACGGGAGTAACTTTAGTAATATCTCCCCTTTGTGCATTGATGGTT
AATCAGGTTGAGAAATTGCGGGCAAAAGGTATTGCAGTGGTCGCTTGGAATTCTGATACCGACATCGAGGAGCGA
CAGACCTTTGAGAAGGACCTCCTTTCTGCAAGCCCGCAGACTCGCCTACTGTATATTTCTCCAGAAAGATACGCG
ACTTCCAATTGCATTCGTTTGTTAGACAGCATTTACAAGAAGCGTAGGCTCAATCGCTTTGTTATTGACGAAGCA
CATTGCATTTCAGAGTGGGGACACAGTTTTCGTAGTGATTATCGTGGCCTTGGAAAATTTCGAGATCGTTATAGT
GACGTTCCAATCATGGCTTTGACTGCCACTGCTACTCCGGTTGTCCAGAGGGATATTTTATATAGTTTGAAGATT
GACAAGAACGACGTGTTTTATGCCGTTCATCCGTTTAACCGGGAGAATCTATTCTACGAGGTCAGATACATGTCA
TTGTTGGATTCGCAGACCAGAAAACAACACATCTTCGATTATATCAACTTACTCCATCAGCGAAGGAAAAGACCA
TCCTCCGGGATCATCTACTGTCGCGCCAAGGCTACGTGCGACGATGTTTCTGATTTTCTTCGGCGAAATGGGCTG
AATGCACAGTCATACCATAGTGGAATTAGTCAGGGAGTCCTTAAGCAGACGCTCAAAAAGTGGTCTGCTGGCGGA
AATGGTGGCCAAAAGACCATTGATGTGGTCGTTGCTACTATTGCTTTCGGCCTCGGAATTGACAAGGACGACGTC
AGATATGTAATCCATTATGATCTTCCTACAAGTTTTGAAGGCTATTACCAAGAGACAGGCAGAGCAGGCAGAGAT
GGACAGCCTTCAAAATGCATCCTATATTATTCCAGGGAAGATGCTCTTGGAATCCGGGAGCGCGTTACAACATCC
AAACCAAATCGTATAAATGATGGTTTTCAAGGCCCATCTCCGACACAGAGAGCCAAGAGTAGCATAGATGAGTTG
ATTCAATACGCGGAAAATGTTGCAACCTGCCGGCATATAGGCATCTGTCGTTATTTTGGAGAAGATGTAGACGAG
AGTAAACCCGACACGGTTGAAAGCTTGTGCGATTCAATGTGTGATGTTTGCAAATACTCAGACAAGACGAAGAAA
CGCATTACTGTCCTCACGCCGCGAGACGAGGTTCAAATTTTCCGTCGACAACGGCAGCGTCCATGTCAAGAAACC
TCGGAGAACCTCCCGGAGGCAAATAAGGTGATACCTTTCCCAGTGAATGGGGGAATTGATACGGGAGAGAATAAA
CGGAGAAATGACGCTGCCGATCCTCCTGGTCCGCCGCGAGCTACCAAGAAAGTCAAGACCGGTCATATCTCCATC
CTAAAAACGCTTCCTTTCCGGTCTATCAATCGATTGAAAAAACCGTTCAAATCACCTCTTTTGACAAAGGACGTA
AATTCTCATATTTCAAACTCTCGATCCGTTATTCTATCCGAAAGTGGCGGTAGCGATTTTACGGCTGAAGTACAG
GGGGAACCAGACATCGAAACAGGCAGCGGCATGGAGGAATATACGGACAGCGCCCTTGGTGTAGAAGCCAATGAG
AGAGACTACTGTCAGAAAAAGCTAGATTCAGTTCCCGAAGACGAGCTTGAATCTCAATTCTTCGCCACCGACGTG
GAGCTAGAGAACTCCATTTCCACCAAGTTGCCATTGCCTCATCGGATGAAGGGATTCGCTACAATCCGAAGATCG
ATGTGTTCACTCAAGAGGAGAGCTTTACGCGACCTTGCTCATTTCAACCCAAATATAGACCAGTGGGAAAAGATC
TTGCAAGATTCAGCGCGGGAGGCGGAGTTTGCTGCTCTATCACTATCTAGCACCTCGAACGGATACAATATTCTA
ATACGAAGGACGGCTCGAGCAGTCTCTCATTTAGCCAACCCGGAACATGGACAAGATGAGGACGTCCTCGGCGAC
GCACAGGATATGATGGATATCATTCGGCGACACTGTGAAATTTGGCAGAATAAAGCAATCCAAGGAGTATGA
Gene >Agabi119p4|104310
ATGCAACAACCTTTGAATGGTTACGAGAAGTGAGTATATGCTCTTCCACACGAATGTGAGCTCATATTTGTGCCG
TAGTGTACTCAAGAGAGGTCTGCTTCCACTCGACAGATGGTGAAGTGTTATCTGACGGAGGCTCAACAGTGTTCG
GGCATACAGAATTCAGAGGGAAACAACAGGATGTGATAGAGGCTGCCATTGCTGGTATGAAGATTCCGTCTGGGT
CTGCGTATGGGATAATATCATTGAGCATTAGGGCGCGATGTTTTTGTATTGGCTCCAACCGGAATGGGAAAGGTG
CGATACTTGTTTTTTATGGATGCGGCCTTAGTTTACGCTTTACAGAGTTTGTGTTTCCAGTTGCCAGCTGTGACC
GCGGAAACGGGAGTAACTTTAGTAATATCTCCCCTTTGTGGTGAGCCGAAAGTCTCTTGACCTCCTGAATAACTC
ATCGACGTCTTCTAGCATTGATGGTTAATCGTATGTTCATTCTTTTTTTATTATTAGAAAGTATCGACAATCCTT
TATTTCAGAGGTTGAGAAATTGCGGGCAAAAGGTATTGCAGTGGTCGCTTGGAATTCTGATACCGACATCGAGGA
GCGACAGACCGTATGTTATCTTCTCGACTTGATGGATTCATTCTGATAACCTTGTCGAACGTAGTTTGAGAAGGA
CCTCCTTTCTGCAAGCCCGCAGACTCGCCTACTGTATAGTACGGTCATTCCTCTATGCATATATTCCCATTAAAA
ACTGAAATGAATCCCAGTTTCTCCAGAAAGATACGCGACTTCCAATTGCATTCGTTTGTTAGACAGCATTTACAA
GAAGCGTAGGCTCAATCGCTTTGTTATTGACGAAGTAAGACTGCATTTTCGTTAGCAGATACCCCACTCACCCTA
TAATAAGGCACATTGCATTTCAGAGTGGGGACACAGTTTTCGTAGTGATTATCGTGGCCTTGGAAAATTTCGAGA
TCGTTATAGTGACGTTCCAATCATGGCTTTGACTGCCACTGCTACTCCGGTGTAAGATTTTACGCCCATTTGCTC
TATGACCCTCTCACCACATGCAGTGTCCAGAGGGATATTTTATATAGTTTGAAGATTGACAAGAACGACGTGTTT
TATGCCGTTCATCCGTTTAACCGGGAGAATCTATTCTACGAGGTGGGTTTCTATTGCAACCTTACTCTCACAAAC
TGTATTGTGCCTCTAGGTCAGATACATGTCATTGTTGGATTCGCAGACCAGAAAACAACACATCTTCGATTATAT
CAACTTACTCCATCAGCGAAGGAAAAGACCATCCTCCGGGATCATCTACTGTCGCGCCAAGGCTACGTGCGACGA
TGTTTCTGATTTTCTTCGGCGAAATGGGCTGAATGCACAGTCATACCATAGTGGAATTAGGTACAGCCGATCATT
CGGTCCCTTTTTTGTGTACCATGTGCTCATTACCCTCATTCTAGTCAGGGAGTCCTTAAGCAGACGCTCAAAAAG
TGGTCTGCTGGCGGAAATGGTGGCCAAAAGACCATTGATGTGGTCAGTCATGAAGCTGTTTTGATTCGTGTCGCT
CCTCTGATGTGAATGCCTTTAGGTCGTTGCTACTATTGCTTTCGGCCTCGGAATTGACAAGGACGACGTCAGGTA
TTGGTACTTGATGTAGATTTAGCTGTATGTGGGTCTCAAAAGATTCATAGATATGTAATCCATTATGATCTTCCT
ACAAGTTTTGAAGGTGCGATGTCTACAGTAAATGATACTTATAGTAATCTGACCTTCTTTCTAGGCTATTACCAA
GAGACAGGTTGGAAATCCCTTATATTCTCATATCAATCTACTCAAGTGCGTCAGGCAGAGCAGGCAGAGATGGAC
AGGTATTTTTAGTGATATTTTGAAAGACTGAAGCATTGATGTTCGGGAAGCCTTCAAAATGCATCCTATATTATT
GTGAGCTTATTCCAACGATTGATGAGTCAGGCTCATAATGTGTTTCCACATAGCCAGGGAAGATGCTCTTGGAAT
CCGGGAGCGCGTTACAACATCCAAACCAAATCGTATAAATGATGGTTTTCAAGGCCCATCTCCGACACAGAGAGC
CAAGAGTAGCATAGATGAGGTAACGACATGCATTATTCATGAATTCAAGTGTGCGACGAGTTTGTATAGTTGATT
CAATACGCGGAAAATGTTGCAACCTGCCGGCATATAGTGCGTGGTGGTTTCTTCGAAACGTCATCAAAAATTTAT
TCAAAGTATCTCAGGGCATCTGTCGTTATTTTGGAGAAGATGTAGACGAGAGTAAACCCGACACGGTTGAAAGCT
TGTGCGATTCAATGTGTGATGTAAGCTCTTCACGCAAATGTTCAAGTGATGTTTTCACTATGCCTATCGCAGGTT
TGCAAATACTCAGACAAGACGAAGAAACGCATTACTGTCCTCACGCCGCGAGACGAGGTTCAAATTTTCCGTCGA
CAACGGCAGCGTCCATGTCAAGGTAAGCAGTCACCATTTATCAAACACTCCAACCAATAACACCTTTAGAAACCT
CGGAGAACCTCCCGGAGGCAAATAAGGTGATACCTTTCCCAGTGAATGGGGGAATTGATACGGGAGAGAATAAAC
GGAGAAATGACGCTGCCGATCCTCCTGGTCCGCCGCGAGCTACCAAGAAAGTCAAGACCGGTCATATCTCCATCC
TAAGTGAGTAGTCCTTATCGTTCTAGATGTGTTATCACCTACGGACAATCAGAAACGCTTCCTTTCCGGTCTATC
AATCGATTGAAAAAACCGTTCAAATCACCTCTTTTGACAAAGGACGTAAATTCTCATATTTCAAACTCTCGATCC
GTTATTCTATCCGAAAGTGGCGGTAGCGATTTTACGGCTGAAGTACAGGGGGAACCAGACATCGAAACAGGCAGC
GGCATGGAGGAATATACGGACAGCGCCCTTGGTGTAGAAGCCAATGAGAGAGACTACTGTCAGAAAAAGCTAGAT
TCAGTTCCCGAAGACGAGCTTGAATCTCAATTCTTCGCCACCGACGTGGAGCTAGAGAACTCCATTTCCACCAAG
TTGCCAGTAAGAGTCTACTCACCTGTTGATTGGGTCACAAACTAACCGATGCTACTCAAAGTTGCCTCATCGGAT
GAAGGGATTCGCTACAATCCGAAGATCGATGTGTTCACTCAAGAGGAGAGCTTTACGCGACCTTGCTCATTTCAA
CCCAAATATAGACCAGTGGTCGGTTCTATTCCATGCAATCTGCTCCAAAGGAAGTTTCTGAATTTGCGCAGGGAA
AAGATCTTGCAAGATTCAGCGCGGGAGGCGGAGTTTGCTGCTCTATCACTATCTAGCACCTCGAACGGATACAAT
ATTCTAATACGAAGGACGGCTCGAGCAGTCTCTCATTTAGCCAACCCGGAACATGGACAAGATGAGGACGTCCTC
GGCGACGCACAGGATATGATGGATATCATTCGGCGACACTGTGAAATTTGGCAGAATAAAGCAATCCAAGGAGTA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail