Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|104060
Gene name
Locationscaffold_07:1637996..1640931
Strand+
Gene length (bp)2935
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B093|A1864_ARTBC Secreted protein ARB_01864 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01864 PE=1 SV=1 49 639 1.0E-118
sp|Q9HDU9|YHE6_SCHPO Uncharacterized protein PB2B2.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.06c PE=3 SV=1 61 621 9.0E-108
sp|Q9US39|YFZ2_SCHPO Uncharacterized protein C1039.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.02 PE=3 SV=1 61 621 3.0E-104
sp|O13781|YEO3_SCHPO Uncharacterized protein C17G6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.03 PE=3 SV=1 61 621 6.0E-87
sp|P38887|YH02_YEAST Uncharacterized protein YHR202W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR202W PE=1 SV=1 59 621 2.0E-72

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|104060
MRLSTLTLLGLILPILRIYACNDHAHARRGGDGHGHGHEHGHGHGHEHEPSVPKGLSPPTRPLEWGDINILHTTD
SHGWLLGHQKTSFPEPNYSADLGDFASFVTHMKKIANEKGVDLLLVDSGDLHDGTGITDGFPPGGVDAHDANEFV
KMLPYDVMAIGNHELYIYANTLDMHENFVPALNGRYLSSNVNITVTGDDGNPLDIPVGERFAKFKTKHGRKITSL
GVLFDFTDNDRNTTVQKVADMVNEQWFKDVIQEEPDLFLLVGHMPVSRDNWPLVFDAIRAVHPTTPILILGGHTH
IRDCVQLDNRSMALESGRYMETVGWMSAKLDRKDSTDDIRFSRRYLDTNRVTYEYHTKKNDHEFDTSLGEKITNG
LQDLSARFHLDTVFGTAPQDYLYLSAPYPSNNSLFSLFINQVVPVALQVNKTESAPPALFMVNSGLIRFDLYSGP
FTRNDQFTIAPFADSFRYLSNIPLSDAMAAFNALNGAGDSERRQETEELVARHYDAIQGYERGEVDLIFNNWLKK
MDQEIDVQRRAMKNLTLGYVTQDSCPGVGDDTQHATIPFFLDVPKFIVSEPPTGDDITSDTPIDFVFVDFIEGSI
LSILNSLQTEKVYTSNDTMRYSDLLSNAVLGVFAQEVWN*
Coding >Agabi119p4|104060
ATGAGACTCTCAACGCTAACCCTTTTGGGTTTGATACTTCCTATACTTCGCATCTATGCCTGCAACGACCATGCT
CATGCTCGACGTGGTGGCGACGGACATGGACATGGACACGAACACGGACACGGACACGGACATGAACATGAACCC
TCTGTGCCCAAAGGTCTTTCCCCTCCGACGCGCCCACTTGAATGGGGTGACATCAACATCCTCCATACCACGGAC
AGTCATGGTTGGTTGTTAGGTCATCAGAAGACTTCTTTCCCCGAACCAAACTACAGTGCTGACTTGGGAGATTTC
GCGTCGTTTGTGACGCACATGAAAAAAATTGCAAATGAGAAGGGCGTTGATCTTCTACTGGTTGACAGTGGTGAT
CTACACGACGGTACGGGTATAACTGATGGATTCCCGCCTGGTGGAGTCGATGCTCATGATGCGAACGAGTTCGTG
AAAATGCTTCCTTATGATGTAATGGCCATTGGAAACCACGAGCTATACATCTACGCAAATACTCTCGACATGCAT
GAAAATTTCGTACCCGCATTAAACGGTCGATACTTGAGTTCGAATGTGAACATCACTGTCACCGGAGATGATGGC
AATCCGCTTGATATTCCTGTCGGTGAACGTTTTGCTAAGTTCAAGACCAAACATGGACGCAAGATAACTTCGCTG
GGTGTTCTATTCGACTTTACAGATAACGATAGAAATACCACTGTCCAGAAGGTGGCTGACATGGTCAATGAACAA
TGGTTCAAGGACGTGATTCAGGAAGAACCTGATCTCTTTTTACTTGTCGGGCATATGCCAGTTTCTCGCGATAAC
TGGCCTTTGGTATTCGACGCCATCCGCGCCGTCCATCCGACTACTCCAATTCTCATCCTAGGAGGCCATACTCAC
ATTCGTGACTGCGTACAACTGGACAACCGGTCAATGGCTTTGGAAAGTGGTCGGTACATGGAAACCGTTGGGTGG
ATGAGTGCCAAGTTGGACCGAAAAGATAGCACGGATGATATTCGATTCAGCAGGAGATATCTCGATACTAATCGT
GTTACGTACGAATACCATACAAAGAAGAATGACCACGAGTTCGACACGAGTTTGGGGGAAAAAATTACCAATGGC
TTGCAAGACCTCAGCGCTCGTTTCCACCTAGATACTGTTTTTGGCACCGCACCTCAGGACTACCTTTACCTATCA
GCACCCTACCCATCGAATAATTCCCTCTTCTCTCTTTTCATCAATCAGGTCGTCCCGGTCGCTCTTCAAGTAAAC
AAGACTGAAAGCGCCCCACCCGCCCTCTTCATGGTTAACTCTGGATTGATCCGTTTCGATCTGTACTCAGGTCCA
TTCACGCGTAATGACCAATTCACAATTGCGCCGTTCGCAGACTCGTTCCGTTACTTATCGAACATACCCCTTTCC
GATGCGATGGCAGCCTTCAATGCCTTGAATGGTGCTGGGGATAGTGAACGACGCCAGGAAACCGAGGAGCTAGTA
GCGCGACACTATGATGCGATCCAAGGGTATGAAAGGGGAGAAGTTGATCTGATTTTCAACAACTGGCTGAAGAAG
ATGGATCAGGAGATTGACGTTCAAAGGAGAGCTATGAAAAATCTGACATTGGGATATGTTACCCAAGATTCCTGT
CCAGGCGTCGGTGATGACACTCAACACGCTACAATTCCCTTCTTCCTCGACGTACCCAAATTCATTGTGTCCGAA
CCGCCGACCGGAGACGATATTACATCTGATACCCCCATAGACTTCGTGTTTGTCGACTTCATTGAGGGAAGTATT
CTGAGTATCTTGAACAGCCTGCAGACAGAAAAAGTTTATACGTCGAACGATACTATGCGGTACTCGGATTTATTG
TCGAATGCTGTTTTGGGAGTTTTTGCACAAGAAGTGTGGAACTAG
Transcript >Agabi119p4|104060
ATGAGACTCTCAACGCTAACCCTTTTGGGTTTGATACTTCCTATACTTCGCATCTATGCCTGCAACGACCATGCT
CATGCTCGACGTGGTGGCGACGGACATGGACATGGACACGAACACGGACACGGACACGGACATGAACATGAACCC
TCTGTGCCCAAAGGTCTTTCCCCTCCGACGCGCCCACTTGAATGGGGTGACATCAACATCCTCCATACCACGGAC
AGTCATGGTTGGTTGTTAGGTCATCAGAAGACTTCTTTCCCCGAACCAAACTACAGTGCTGACTTGGGAGATTTC
GCGTCGTTTGTGACGCACATGAAAAAAATTGCAAATGAGAAGGGCGTTGATCTTCTACTGGTTGACAGTGGTGAT
CTACACGACGGTACGGGTATAACTGATGGATTCCCGCCTGGTGGAGTCGATGCTCATGATGCGAACGAGTTCGTG
AAAATGCTTCCTTATGATGTAATGGCCATTGGAAACCACGAGCTATACATCTACGCAAATACTCTCGACATGCAT
GAAAATTTCGTACCCGCATTAAACGGTCGATACTTGAGTTCGAATGTGAACATCACTGTCACCGGAGATGATGGC
AATCCGCTTGATATTCCTGTCGGTGAACGTTTTGCTAAGTTCAAGACCAAACATGGACGCAAGATAACTTCGCTG
GGTGTTCTATTCGACTTTACAGATAACGATAGAAATACCACTGTCCAGAAGGTGGCTGACATGGTCAATGAACAA
TGGTTCAAGGACGTGATTCAGGAAGAACCTGATCTCTTTTTACTTGTCGGGCATATGCCAGTTTCTCGCGATAAC
TGGCCTTTGGTATTCGACGCCATCCGCGCCGTCCATCCGACTACTCCAATTCTCATCCTAGGAGGCCATACTCAC
ATTCGTGACTGCGTACAACTGGACAACCGGTCAATGGCTTTGGAAAGTGGTCGGTACATGGAAACCGTTGGGTGG
ATGAGTGCCAAGTTGGACCGAAAAGATAGCACGGATGATATTCGATTCAGCAGGAGATATCTCGATACTAATCGT
GTTACGTACGAATACCATACAAAGAAGAATGACCACGAGTTCGACACGAGTTTGGGGGAAAAAATTACCAATGGC
TTGCAAGACCTCAGCGCTCGTTTCCACCTAGATACTGTTTTTGGCACCGCACCTCAGGACTACCTTTACCTATCA
GCACCCTACCCATCGAATAATTCCCTCTTCTCTCTTTTCATCAATCAGGTCGTCCCGGTCGCTCTTCAAGTAAAC
AAGACTGAAAGCGCCCCACCCGCCCTCTTCATGGTTAACTCTGGATTGATCCGTTTCGATCTGTACTCAGGTCCA
TTCACGCGTAATGACCAATTCACAATTGCGCCGTTCGCAGACTCGTTCCGTTACTTATCGAACATACCCCTTTCC
GATGCGATGGCAGCCTTCAATGCCTTGAATGGTGCTGGGGATAGTGAACGACGCCAGGAAACCGAGGAGCTAGTA
GCGCGACACTATGATGCGATCCAAGGGTATGAAAGGGGAGAAGTTGATCTGATTTTCAACAACTGGCTGAAGAAG
ATGGATCAGGAGATTGACGTTCAAAGGAGAGCTATGAAAAATCTGACATTGGGATATGTTACCCAAGATTCCTGT
CCAGGCGTCGGTGATGACACTCAACACGCTACAATTCCCTTCTTCCTCGACGTACCCAAATTCATTGTGTCCGAA
CCGCCGACCGGAGACGATATTACATCTGATACCCCCATAGACTTCGTGTTTGTCGACTTCATTGAGGGAAGTATT
CTGAGTATCTTGAACAGCCTGCAGACAGAAAAAGTTTATACGTCGAACGATACTATGCGGTACTCGGATTTATTG
TCGAATGCTGTTTTGGGAGTTTTTGCACAAGAAGTGTGGAACTAG
Gene >Agabi119p4|104060
ATGAGACTCTCAACGCTAACCCTTTTGGGTTTGATACTTCCTATACTTCGCATCTATGCCTGCAACGACCATGCT
CATGCTCGACGTGGTGGCGACGGACATGGACATGGACACGAACACGGACACGGACACGGACATGAACATGAACCC
TCTGTGCCCAAAGGTCTTTCCCCTCCGACGCGCCCACTTGAATGGGGTGACATCAACATCCTCCATACCACGGAC
AGTCATGGTTGGTTGTTAGGTCATCAGAAGACTTCTTTCCCCGAACCAAACTACAGGTGCGTTTCCGATTCAGCA
TGCGAAACGTGCAGATACATATACAGCTTTGTTAGTGCTGACTTGGGAGATTTCGCGTCGTTTGTGACGCACATG
AAAAAAATTGCAAATGTTAGCTTTGAATGCCCCTGAGAGCGTTTTCATTGACCTTCATTGAAAATTCATAGGAGA
AGGGCGTTGATCTTCTACTGGTTGACAGTGGTGATCTACACGACGGTAGGCTGGATTATGGTTTTGAAATTTCTG
ATAGAAAATTTGACGCTTTGTATAGGTACGGGTATAACTGATGGATTCCCGCCTGGTGGAGTCGATGCTCATGAT
GTGCGTATCTTCGTATCTGGAATTGGGGATATCATATATTAATCCGACTAGGCGAACGAGTTCGTGAAAATGCTT
CCTTATGATGTAATGGCCATTGGAAAGTAGGTCTTGAGTCTGTGGCTTTCGTGGCCTCCTCCGATTATTTGAACT
CACCTTTGGATAGCCACGAGCTATACATCTACGCAAATACTCTCGACATGTAGGGACAACATTTCCTGTATTTAG
CGACAGGTTCTAACGGCACTTAACAGGCATGAAAATTTCGTACCCGCATTAAACGGTCGATACTTGAGTTCGAAT
GTGAACATCACTGTCACCGGAGATGATGGCAATCCGCTTGATATTCCTGTCGGTGGTACGTCCAGACTTATTAGT
ATCAACGTTTGTGCTTCCCGACTGACATTTATACAGAACGTTTTGCTAAGTTCAAGACCAAACAGTGAGTGTCGG
TCATTTAGTTCAACAGGATGATAACTTAACATGTATTCGCATTGTCACCATCAGTGGACGCAAGATAACTTCGCT
GGGTGTTCTATTCGACTTTACAGATAACGATAGAAATACCACTGTCCAGAAGGTGGCTGACATGGTCAATGAACA
ATGGGTTCGTAATACTGGTATTGGTTCGGTCAAGAGAATATATTTACCAATTGTCACCAGTTCAAGGACGTGATT
CAGGAAGAACCTGATCTCTTTTTACTTGTCGGGTAAGAATCGATCCTTTCAATTGGGCACGGGAATTATTGTCGA
CATTGATTACCTTCAGGCATATGCCAGTTTCTCGCGATAACTGTACGAGGGCTGTTTTAATTGCTGAAAACTTCC
TGAGAAAATATAAACAGGGCCTTTGGTATTCGACGCCATCCGCGCCGTCCATCCGACTACTCCAATTCTCATCCT
AGGAGGTAAAGTCTCACGTTTGGGCAGTTGGACAAAGCTGACATATGGCTGCAGGCCATACTCACATTCGTGACT
GCGGTTAGTATTACAAAACCCTCTCTCATGCACAGGCAAAGTGGCTAACACTGGAGGTAGTACAACTGGACAACC
GGTCAATGGCTTTGGAAAGTGGTCGGTACATGGAAACCGTTGGTACGTTCCCCATTTAGGCTCCGACGTCGGTTT
CGATTTTATCCTTACATTGCTCTTGAACAGGGTGGATGAGTACGTGACAGCTTTATATTATTTGATTTCTTGAAG
TAGATGGATATGCAGGTGCCAAGTTGGACCGAAAAGATAGCACGGATGATATTCGATTCAGCAGGAGATATCTCG
ATACTAATCGTGTTACGTACGAAGTACGAGGTTTCTCAGCATGCCACGAAACGTGAACTTACCACAGTCGACGTC
CAGTACCATACAAAGAAGAATGACCACGAGTTCGACACGAGTTTGGGGGAAAAAATTACCAATGGCTTGCAAGAC
CTCAGCGCTCGTTTCCACCTAGATACTGTTTTTGGCACCGCACCTCAGGACTACCTTTACCTATCGTATGTTGTC
TATCGCACCTCTTACATTCAATACGACATCCCGCTTACCCATGTGGCATCTCCAGAGCACCCTACCCATCGAATA
ATTCCCTCTTCTCTCTTTTCATCAATCAGGTCGTCCCGGTCGCTCTTCAAGTAAACAAGACTGAAAGCGCCCCAC
CCGCCCTCTTCATGGTTAACTCTGGATTGATCCGTTTCGATCTGTACTCAGGTCCATTCACGCGTAATGACCAAT
TCACAATTGCGCCGTTCGCAGACTCGTTCCGTTACTTATCGAACATACCCCTTTCCGATGCGATGGCAGCCTTCA
ATGCCTTGAATGGTGCTGGGGATAGTGAACGACGCCAGGAAACCGAGGAGCTAGTAGCGCGACACTATGATGCGA
TCCAAGGGTATGAAAGGGGAGAAGTTGATCTGATTTTCAACAACTGGCTGAAGAAGATGGATCAGGAGATTGACG
TTCAAAGGAGAGCTATGAAAAATCTGACATTGGGATATGTTACCCAAGATGTAAGTCCTTCGTTCGTTTTGTATC
CTCATGGTTTTCTGATATTATGCATGAACTTCAGTCCTGTCCAGGCGTCGGTGATGACACTCAACACGCTACAAT
TCCCTTCTTCCTCGACGTACCCAAATTCATTGTGTCCGAACCGCCGACCGGAGACGATATTACATCTGATACCCC
CATAGACTTCGTGTTTGTCGACTTCATTGAGGGAAGTATTCTGAGTATCTTGAACAGCCTGCAGACAGAAAAAGT
TTATACGTCGAACGATACTATGCGGTACTCGGATTTATTGTCGAATGCTGTTTTGGGAGTTTTTGCACAAGAAGT
GTGGAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail