Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|104050
Gene name
Locationscaffold_07:1634493..1636610
Strand+
Gene length (bp)2117
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 1.4E-30 70 281
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 7.6E-21 446 545

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 85 546 7.0E-48

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|104050
MIGNILRALPVVVLTAHSCRAAPTEGKGWHFVQNGTTGIVALESIIVSDTLAVFFDRATDNPLQIDGHPAWGALW
NLETNTASPLNVTTDAFCATGSFLSNGTMVSIGGHTPAIPEAKDGRNGLRIWEPCDDPNGEGCGLFEDPETLHMA
ETRWYATSLRMFDGSIMIIGGMHKKTSFNNDDPTNSIEFFPPKDGGVPRPLDLLERTLPANLYPRSFALPDGKIF
MAAANQTIIYDFEANTETRLPDIPNNVRITNPLDGTATLLPLHPPDYIPEILICGGTNTSDQLPVEELSSQTPAS
DQCSRMTLTPEGIERGWEIERMLEPRIMPEMILLPNGEIVIISGAQTGYAAISGVKDPVGNNSNADHPAFTPSIY
TPDAPLGQRISNAGMPTTDIARIYHSSVTLTPKGNLLLAGSSPNTVVVNGTQYPSEFRAEYLNPPYMTVERPQLS
NVPKQIAFNSEFSVDVSVPSRLTQGDLKVALMDLGFSTHGFHSSSRLVFMDAQLSEDGKTLSIKSPPNNRVYPPG
PAYIFLTVGDVSSTGVRVMVGNGATPPVEDQGVPI*
Coding >Agabi119p4|104050
ATGATTGGGAACATCCTTCGAGCATTGCCGGTGGTCGTCCTCACCGCACATTCTTGTCGAGCTGCCCCTACGGAG
GGCAAGGGATGGCATTTTGTGCAGAATGGAACTACTGGGATTGTCGCGTTGGAGTCCATCATCGTCTCCGATACG
CTGGCTGTCTTCTTCGATCGGGCCACAGACAATCCACTGCAAATCGATGGACATCCTGCTTGGGGTGCATTGTGG
AATCTGGAAACAAATACTGCAAGCCCCTTGAACGTTACTACCGACGCATTCTGCGCCACGGGAAGTTTCTTGTCC
AACGGAACAATGGTCAGTATTGGCGGACATACGCCTGCGATTCCTGAAGCCAAAGATGGGCGTAACGGGCTCAGG
ATCTGGGAGCCTTGTGATGATCCCAACGGCGAAGGTTGTGGCCTGTTTGAGGATCCGGAAACTCTCCATATGGCT
GAAACCAGGTGGTATGCAACAAGTTTGAGGATGTTCGACGGATCTATTATGATTATCGGTGGCATGCACAAAAAA
ACTTCTTTCAATAATGATGACCCCACAAACAGCATCGAGTTCTTCCCGCCCAAAGACGGCGGAGTTCCAAGGCCA
TTGGACCTTCTGGAGCGGACTCTTCCAGCCAACCTTTACCCTCGGTCTTTTGCGCTACCAGATGGCAAAATCTTC
ATGGCCGCCGCAAACCAAACTATAATCTACGACTTCGAAGCCAATACAGAGACGAGGCTCCCGGACATACCCAAC
AACGTCCGTATCACGAATCCTCTCGACGGGACGGCTACCCTTCTTCCTCTTCACCCACCCGACTACATTCCAGAA
ATTCTTATTTGCGGTGGGACAAACACAAGTGACCAACTGCCTGTGGAAGAACTATCGTCGCAGACACCTGCGTCA
GATCAATGCAGCCGTATGACGCTGACACCTGAAGGTATTGAACGCGGGTGGGAAATCGAAAGAATGCTGGAGCCT
AGGATTATGCCAGAGATGATCTTGCTGCCAAATGGAGAAATAGTTATTATTAGCGGTGCGCAGACTGGGTATGCT
GCTATTTCTGGCGTGAAAGATCCGGTCGGCAACAACTCGAATGCGGACCACCCAGCATTCACTCCATCTATCTAC
ACGCCTGATGCTCCTCTCGGACAACGTATCAGCAACGCGGGAATGCCAACGACTGACATAGCACGCATATATCAT
TCGTCCGTGACTCTTACACCGAAAGGAAATCTTCTGCTCGCTGGCTCCAGTCCCAATACTGTCGTCGTTAATGGA
ACTCAATACCCGAGTGAATTCCGGGCGGAGTACTTGAATCCCCCATACATGACTGTAGAGAGACCCCAATTGTCC
AATGTTCCGAAGCAAATAGCTTTTAACTCCGAGTTCAGCGTGGATGTTTCCGTTCCTTCACGTCTCACCCAGGGA
GATCTAAAGGTTGCGTTAATGGACCTTGGTTTCTCAACACACGGTTTCCATTCGAGCTCCCGCCTTGTATTTATG
GATGCTCAGCTGTCTGAGGATGGGAAAACATTGAGTATCAAGAGTCCGCCTAATAACCGTGTTTATCCTCCCGGT
CCGGCGTATATCTTCTTGACCGTTGGCGACGTCAGTAGTACTGGAGTCAGAGTCATGGTTGGGAATGGCGCTACC
CCACCGGTTGAGGACCAAGGAGTTCCAATTTAG
Transcript >Agabi119p4|104050
ATGATTGGGAACATCCTTCGAGCATTGCCGGTGGTCGTCCTCACCGCACATTCTTGTCGAGCTGCCCCTACGGAG
GGCAAGGGATGGCATTTTGTGCAGAATGGAACTACTGGGATTGTCGCGTTGGAGTCCATCATCGTCTCCGATACG
CTGGCTGTCTTCTTCGATCGGGCCACAGACAATCCACTGCAAATCGATGGACATCCTGCTTGGGGTGCATTGTGG
AATCTGGAAACAAATACTGCAAGCCCCTTGAACGTTACTACCGACGCATTCTGCGCCACGGGAAGTTTCTTGTCC
AACGGAACAATGGTCAGTATTGGCGGACATACGCCTGCGATTCCTGAAGCCAAAGATGGGCGTAACGGGCTCAGG
ATCTGGGAGCCTTGTGATGATCCCAACGGCGAAGGTTGTGGCCTGTTTGAGGATCCGGAAACTCTCCATATGGCT
GAAACCAGGTGGTATGCAACAAGTTTGAGGATGTTCGACGGATCTATTATGATTATCGGTGGCATGCACAAAAAA
ACTTCTTTCAATAATGATGACCCCACAAACAGCATCGAGTTCTTCCCGCCCAAAGACGGCGGAGTTCCAAGGCCA
TTGGACCTTCTGGAGCGGACTCTTCCAGCCAACCTTTACCCTCGGTCTTTTGCGCTACCAGATGGCAAAATCTTC
ATGGCCGCCGCAAACCAAACTATAATCTACGACTTCGAAGCCAATACAGAGACGAGGCTCCCGGACATACCCAAC
AACGTCCGTATCACGAATCCTCTCGACGGGACGGCTACCCTTCTTCCTCTTCACCCACCCGACTACATTCCAGAA
ATTCTTATTTGCGGTGGGACAAACACAAGTGACCAACTGCCTGTGGAAGAACTATCGTCGCAGACACCTGCGTCA
GATCAATGCAGCCGTATGACGCTGACACCTGAAGGTATTGAACGCGGGTGGGAAATCGAAAGAATGCTGGAGCCT
AGGATTATGCCAGAGATGATCTTGCTGCCAAATGGAGAAATAGTTATTATTAGCGGTGCGCAGACTGGGTATGCT
GCTATTTCTGGCGTGAAAGATCCGGTCGGCAACAACTCGAATGCGGACCACCCAGCATTCACTCCATCTATCTAC
ACGCCTGATGCTCCTCTCGGACAACGTATCAGCAACGCGGGAATGCCAACGACTGACATAGCACGCATATATCAT
TCGTCCGTGACTCTTACACCGAAAGGAAATCTTCTGCTCGCTGGCTCCAGTCCCAATACTGTCGTCGTTAATGGA
ACTCAATACCCGAGTGAATTCCGGGCGGAGTACTTGAATCCCCCATACATGACTGTAGAGAGACCCCAATTGTCC
AATGTTCCGAAGCAAATAGCTTTTAACTCCGAGTTCAGCGTGGATGTTTCCGTTCCTTCACGTCTCACCCAGGGA
GATCTAAAGGTTGCGTTAATGGACCTTGGTTTCTCAACACACGGTTTCCATTCGAGCTCCCGCCTTGTATTTATG
GATGCTCAGCTGTCTGAGGATGGGAAAACATTGAGTATCAAGAGTCCGCCTAATAACCGTGTTTATCCTCCCGGT
CCGGCGTATATCTTCTTGACCGTTGGCGACGTCAGTAGTACTGGAGTCAGAGTCATGGTTGGGAATGGCGCTACC
CCACCGGTTGAGGACCAAGGAGTTCCAATTTAG
Gene >Agabi119p4|104050
ATGATTGGGAACATCCTTCGAGCATTGCCGGTGGTCGTCCTCACCGCACATTCTTGTCGAGCTGCCCCTACGGAG
GGCAAGGGATGGCATTTTGTGCAGAATGGAACTACTGGGATTGTCGCGTTGGAGTCCATCATCGTCTCCGATACG
CTGGCTGTCTTCTTCGATCGGGCCACAGACAATCCACTGCAAATCGATGGACATCCTGCTTGGGGTGCATTGTGG
AATCTGGAAACAAATACTGCAAGCCCCTTGAACGTTACTACCGACGCATTCTGCGCCACGGGAAGTTTCTTGTCC
AACGGAACAATGGTATGTACTTATGGTTATGATAATATTCAGCCGTGACAAGCCCACTTTAACAGGTCAGTATTG
GCGGACATACGCCTGCGATTCCTGAAGCCAAAGATGGGCGTAACGGGCTCAGGATCTGGGAGCCTTGTGATGATC
CCAACGGCGAAGGTTGTGGCCTGTTTGAGGATCCGGAAACTCTCCATATGGCTGAAACCAGGTGGTATGCAACAA
GTTTGAGGATGTTCGACGGATCTATTGTGAGTTTTTACTCTACAACGGTGCGCTTAATTTCTATAAAACACTGCC
CATCTAGATGATTATCGGTGGCATGCACAAAAAAACTTCTTTCAATAATGATGACCCCACAAACAGCATCGAGTT
CTTCCCGCCCAAAGACGGCGGAGTTCCAAGGCCATTGGACCTTCTGGAGCGGACTCTTCCAGCCAACCTTTACCC
TCGGTATGTATACATAAACCCAAGGCTTGAGAAACCACGGTAATGTCATCGCCATCAGGTCTTTTGCGCTACCAG
ATGGCAAAATCTTCATGGCCGCCGCAAACCAAACTATAATCTACGACTTCGAAGCCAATACAGAGACGAGGCTCC
CGGACATACCCAACAACGTCCGTATCACGAATCCTCTCGACGGGACGGCTACCCTTCTTCCTCTTCACCCACCCG
ACTACATTCCAGAAATTCTTATTTGCGGTGGGACAAACACAAGTGACCAACTGCCTGTGGAAGAACTATCGTCGC
AGACACCTGCGTCAGATCAATGCAGCCGTATGACGCTGACACCTGAAGGTATTGAACGCGGGTGGGAAATCGAAA
GAATGCTGGAGCCTAGGATTATGCCAGAGATGATCTTGCTGCCAAATGGAGAAATAGTTATTATTAGCGGTGCGC
AGACTGGGTATGCTGCTATTTCTGGCGTGAAAGATCCGGTCGGCAACAACTCGAATGCGGACCACCCAGCGTAAG
TTGACATTGATGATTCATGACTTCCGAGCAATGTATACACAATGACTGAAATCCGTAGATTCACTCCATCTATCT
ACACGCCTGATGCTCCTCTCGGACAACGTATCAGCAACGCGGGAATGCCAACGACTGACATAGCACGCATATATC
ATTCGTCCGTGACTCTTACACCGAAAGGGTGAGCCATATAACAATATGAAATCATATAGTTAACATTCCTCTTCC
AGAAATCTTCTGCTCGCTGGCTCCAGTCCCAATACTGTCGTCGTTAATGGAACTCAATACCCGAGGTAAATAATC
CATCGTTGCATAGAACATAAATCACATCTTTTACTCCATAATCCCAGTGAATTCCGGGCGGAGTACTTGAATCCC
CCATACATGACTGTAGAGAGACCCCAATTGTCCAATGTTCCGAAGCAAATAGCTTTTAACTCCGAGTTCAGCGTG
GATGTTTCCGTTCCTTCACGTCTCACCCAGGGAGATCTAAAGGGTAAGTAAGATTTTATTTATAGACAGATCGAC
ACTCATAGACTCGGACAGTTGCGTTAATGGACCTTGGTTTCTCAACACACGGTTTCCATTCGAGCTCCCGCCTTG
TATTTATGGATGCTCAGCTGTCTGAGGATGGGAAAACATTGAGTATCAAGAGTCCGCCTAATAACCGTGTTTATC
CTCCCGGTCCGGGTATGTAATGAGCCTAATGATCCACTTATGTGGTCACTGACATAACTATAGCGTATATCTTCT
TGACCGTTGGCGACGTCAGTAGTACTGGAGTCAGAGTCATGGTTGGGAATGGCGCTACCCCACCGGTTGAGGACC
AAGGAGTTCCAATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail