Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|104000
Gene name
Locationscaffold_07:1623391..1626920
Strand+
Gene length (bp)3529
Transcript length (bp)2736
Coding sequence length (bp)2736
Protein length (aa) 912

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09794 Avl9 Transport protein Avl9 6.0E-127 170 536

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVL9 PE=1 SV=1 166 599 3.0E-90
sp|O13943|AVL9_SCHPO Late secretory pathway protein avl9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avl9 PE=3 SV=2 170 607 2.0E-89
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 165 380 7.0E-47
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 165 380 1.0E-46
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 165 380 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVL9 PE=1 SV=1 166 599 3.0E-90
sp|O13943|AVL9_SCHPO Late secretory pathway protein avl9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avl9 PE=3 SV=2 170 607 2.0E-89
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 165 380 7.0E-47
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 165 380 1.0E-46
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 165 380 1.0E-46
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 411 621 7.0E-19
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 411 621 1.0E-18
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 411 594 4.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|104000
MEPPPTAAAHSQPDHDSDADTASQRSISLDSPPLSPRTDARDFLANPGAFLRSDDKRESNQFTVDTDFSSDTDDM
SMHKHRASVVAESPNTTAPPSIFEEEPLTATKQSINGLVDSQPSSSLPTPMATTYPPTPSAHDDTISISSLTSNT
SSRKARPESLLVSPPEGPLVLGIALVDFNHLVGPRIEWSKGDIFNDEEVAKILPFLALPDGAHLSTEDYSYFHLV
PPGLNTTTIFGISCNQQIASKLLLVKDPDVTRSIVQKAVVVLASKPVFGPIRDKLRVVTTALFQQRDFTDISILD
IFAVNLEPSLRGQLTESGLYMGTSLREFVHTFRHRTLILVKALILQKRIMFYGHPVERLCTYQYSLISLIPGLLQ
HLEDCGSPPLSNRAPTLSRPNSLKTSDHKSMMAFMGMPLDVFGKDAFFQPYLPLQQLDMLVGTPSWLCGSTNSIV
TQQKEIDLFVDTETGMIEIRDPRLERSVALTAADRKWMDDIVNDVNANWDDEDPGRASSMQTRFKGSDDYLRTKF
EEYISAALSSVKYRDFVAKGEGNGVLITGGTGGDVASMEDFNSLWISEFRGTNAYAVWDRITDPVIFDIIEPRHP
CTDKPSVVSDLGLRLHEGIQDLKLDQQLAPAREAVARTFATGSTNFFKAVEGVKGRWRQPSAGSIHTTTSATAST
DDSGLSTPIEVSKSDFEPQHDKGGRPDVVGSPQSGTLRSFSFFSSATSTPTPGASAVNGQSAAGSPAPAFQDHVR
SASVTASTAASAAATNLTTWGAGIGSFFSSKLARTKSTDATATPTRQQQQQEKPLPPSAVDLKSSTSLPPLPSLV
TQSPVTSTSASFRDSDSGTIFSATSPTTTVPITHKATIAGEARVVSMTTATTPLKESRRSVEKKANVVEDEVSDG
AGETVYSGVAL*
Coding >Agabi119p4|104000
ATGGAACCACCGCCGACAGCTGCTGCACACAGCCAGCCAGACCACGACTCGGACGCAGACACCGCCTCCCAACGC
TCCATCTCCCTCGATTCCCCGCCCCTGTCTCCCAGGACAGATGCCCGCGACTTTCTCGCGAACCCAGGCGCCTTT
CTCCGCTCGGACGACAAGCGCGAGTCCAACCAGTTCACCGTCGACACAGACTTTAGTTCGGACACAGACGACATG
AGCATGCACAAGCATAGAGCGTCTGTCGTTGCAGAGTCGCCAAACACCACCGCTCCACCCTCGATATTCGAAGAG
GAGCCACTAACAGCGACAAAGCAGTCCATCAATGGTCTTGTGGATTCACAACCGTCGTCTTCGCTTCCAACCCCC
ATGGCAACAACGTATCCACCCACCCCTTCAGCACACGACGACACTATTTCGATATCTTCCCTGACATCAAACACG
TCTTCTCGCAAAGCTCGGCCTGAGTCTCTTCTCGTGAGTCCTCCAGAAGGGCCTCTAGTGCTGGGCATCGCCCTG
GTCGACTTTAATCACCTGGTTGGCCCTCGCATAGAGTGGTCAAAAGGTGATATTTTTAATGATGAAGAGGTTGCC
AAAATACTGCCTTTCCTTGCCCTCCCTGACGGTGCCCATCTCTCAACCGAAGACTACTCGTATTTCCACCTTGTG
CCTCCCGGTCTCAATACCACAACTATTTTTGGCATCTCATGCAATCAACAAATCGCTTCAAAATTATTACTCGTC
AAAGACCCCGATGTCACTCGTTCGATAGTCCAAAAAGCGGTGGTCGTTTTGGCCTCCAAACCCGTTTTTGGCCCA
ATTAGGGACAAGTTGCGGGTAGTGACAACGGCTCTCTTTCAGCAAAGAGACTTTACGGATATTAGTATATTGGAT
ATTTTCGCCGTCAATTTGGAACCAAGTTTAAGAGGACAATTGACGGAAAGCGGGTTGTATATGGGTACAAGTCTC
CGTGAATTTGTGCATACCTTCCGGCATCGTACTCTTATCCTTGTCAAAGCATTAATACTTCAGAAGAGGATCATG
TTTTATGGTCATCCCGTAGAACGACTATGTACATATCAATATTCCCTAATATCATTGATACCCGGTTTATTACAA
CATCTGGAAGATTGTGGCTCCCCACCGCTCTCTAATAGAGCACCGACTCTTTCACGGCCTAATTCTTTGAAGACT
TCCGACCATAAGAGCATGATGGCTTTTATGGGGATGCCGCTAGACGTATTTGGCAAGGATGCATTTTTCCAACCC
TATCTTCCGCTCCAGCAGCTGGATATGCTGGTGGGAACGCCTAGCTGGTTGTGTGGGAGCACGAATTCGATTGTG
ACCCAACAAAAGGAAATCGATTTATTTGTGGATACCGAAACTGGGATGATTGAGATTCGTGATCCAAGATTAGAA
CGTTCGGTGGCGTTGACCGCGGCAGACCGTAAATGGATGGATGATATCGTGAACGATGTTAATGCGAATTGGGAT
GATGAGGATCCGGGCAGGGCGTCAAGCATGCAAACTAGGTTCAAAGGGAGCGATGATTATCTAAGGACCAAATTT
GAGGAGTATATCTCGGCTGCGTTGTCGTCCGTCAAGTACCGAGACTTCGTAGCGAAAGGTGAAGGAAATGGCGTA
TTGATCACTGGTGGAACTGGTGGTGATGTGGCGAGCATGGAGGATTTCAATTCTTTATGGATATCTGAATTCCGA
GGTACCAATGCATATGCAGTCTGGGACCGCATTACAGATCCAGTAATTTTTGACATCATTGAACCTCGACACCCA
TGTACAGATAAACCATCGGTCGTATCAGATCTAGGTTTACGACTACACGAAGGTATTCAAGATCTCAAACTTGAT
CAACAACTGGCACCTGCTCGAGAAGCCGTGGCTAGGACATTCGCTACTGGGTCAACGAATTTCTTCAAAGCCGTA
GAAGGGGTAAAAGGACGATGGCGACAGCCAAGTGCTGGTTCGATACATACTACTACCAGTGCGACAGCTTCCACG
GATGATTCGGGTTTGAGTACACCCATTGAGGTGTCCAAATCGGATTTCGAACCTCAACATGATAAGGGAGGAAGG
CCGGATGTGGTAGGGTCTCCACAATCGGGAACATTGAGATCGTTTTCGTTCTTCTCTTCGGCAACATCAACGCCG
ACGCCAGGCGCGAGTGCGGTAAACGGGCAGTCAGCTGCTGGTAGTCCTGCCCCTGCGTTCCAGGATCATGTCAGA
AGTGCTTCTGTAACGGCGTCTACAGCGGCTTCTGCTGCAGCGACCAACTTGACGACTTGGGGTGCTGGGATTGGA
TCGTTTTTCTCGTCAAAGTTGGCGAGGACTAAATCGACTGATGCTACTGCTACCCCCACTCGACAGCAGCAGCAG
CAGGAGAAACCGTTACCACCTAGTGCTGTGGATTTGAAATCTTCGACTTCACTTCCTCCTTTACCTTCTTTGGTT
ACACAGTCGCCCGTGACATCGACTTCGGCTAGTTTTAGAGATTCGGACTCAGGAACTATATTTTCAGCGACATCG
CCAACGACTACGGTACCTATCACGCATAAGGCGACTATTGCTGGAGAGGCGCGTGTGGTATCAATGACGACGGCG
ACTACTCCGTTGAAGGAAAGTAGAAGGAGTGTTGAGAAGAAAGCAAATGTGGTTGAAGATGAAGTTTCGGATGGG
GCGGGTGAGACGGTGTATAGTGGTGTGGCGTTGTAG
Transcript >Agabi119p4|104000
ATGGAACCACCGCCGACAGCTGCTGCACACAGCCAGCCAGACCACGACTCGGACGCAGACACCGCCTCCCAACGC
TCCATCTCCCTCGATTCCCCGCCCCTGTCTCCCAGGACAGATGCCCGCGACTTTCTCGCGAACCCAGGCGCCTTT
CTCCGCTCGGACGACAAGCGCGAGTCCAACCAGTTCACCGTCGACACAGACTTTAGTTCGGACACAGACGACATG
AGCATGCACAAGCATAGAGCGTCTGTCGTTGCAGAGTCGCCAAACACCACCGCTCCACCCTCGATATTCGAAGAG
GAGCCACTAACAGCGACAAAGCAGTCCATCAATGGTCTTGTGGATTCACAACCGTCGTCTTCGCTTCCAACCCCC
ATGGCAACAACGTATCCACCCACCCCTTCAGCACACGACGACACTATTTCGATATCTTCCCTGACATCAAACACG
TCTTCTCGCAAAGCTCGGCCTGAGTCTCTTCTCGTGAGTCCTCCAGAAGGGCCTCTAGTGCTGGGCATCGCCCTG
GTCGACTTTAATCACCTGGTTGGCCCTCGCATAGAGTGGTCAAAAGGTGATATTTTTAATGATGAAGAGGTTGCC
AAAATACTGCCTTTCCTTGCCCTCCCTGACGGTGCCCATCTCTCAACCGAAGACTACTCGTATTTCCACCTTGTG
CCTCCCGGTCTCAATACCACAACTATTTTTGGCATCTCATGCAATCAACAAATCGCTTCAAAATTATTACTCGTC
AAAGACCCCGATGTCACTCGTTCGATAGTCCAAAAAGCGGTGGTCGTTTTGGCCTCCAAACCCGTTTTTGGCCCA
ATTAGGGACAAGTTGCGGGTAGTGACAACGGCTCTCTTTCAGCAAAGAGACTTTACGGATATTAGTATATTGGAT
ATTTTCGCCGTCAATTTGGAACCAAGTTTAAGAGGACAATTGACGGAAAGCGGGTTGTATATGGGTACAAGTCTC
CGTGAATTTGTGCATACCTTCCGGCATCGTACTCTTATCCTTGTCAAAGCATTAATACTTCAGAAGAGGATCATG
TTTTATGGTCATCCCGTAGAACGACTATGTACATATCAATATTCCCTAATATCATTGATACCCGGTTTATTACAA
CATCTGGAAGATTGTGGCTCCCCACCGCTCTCTAATAGAGCACCGACTCTTTCACGGCCTAATTCTTTGAAGACT
TCCGACCATAAGAGCATGATGGCTTTTATGGGGATGCCGCTAGACGTATTTGGCAAGGATGCATTTTTCCAACCC
TATCTTCCGCTCCAGCAGCTGGATATGCTGGTGGGAACGCCTAGCTGGTTGTGTGGGAGCACGAATTCGATTGTG
ACCCAACAAAAGGAAATCGATTTATTTGTGGATACCGAAACTGGGATGATTGAGATTCGTGATCCAAGATTAGAA
CGTTCGGTGGCGTTGACCGCGGCAGACCGTAAATGGATGGATGATATCGTGAACGATGTTAATGCGAATTGGGAT
GATGAGGATCCGGGCAGGGCGTCAAGCATGCAAACTAGGTTCAAAGGGAGCGATGATTATCTAAGGACCAAATTT
GAGGAGTATATCTCGGCTGCGTTGTCGTCCGTCAAGTACCGAGACTTCGTAGCGAAAGGTGAAGGAAATGGCGTA
TTGATCACTGGTGGAACTGGTGGTGATGTGGCGAGCATGGAGGATTTCAATTCTTTATGGATATCTGAATTCCGA
GGTACCAATGCATATGCAGTCTGGGACCGCATTACAGATCCAGTAATTTTTGACATCATTGAACCTCGACACCCA
TGTACAGATAAACCATCGGTCGTATCAGATCTAGGTTTACGACTACACGAAGGTATTCAAGATCTCAAACTTGAT
CAACAACTGGCACCTGCTCGAGAAGCCGTGGCTAGGACATTCGCTACTGGGTCAACGAATTTCTTCAAAGCCGTA
GAAGGGGTAAAAGGACGATGGCGACAGCCAAGTGCTGGTTCGATACATACTACTACCAGTGCGACAGCTTCCACG
GATGATTCGGGTTTGAGTACACCCATTGAGGTGTCCAAATCGGATTTCGAACCTCAACATGATAAGGGAGGAAGG
CCGGATGTGGTAGGGTCTCCACAATCGGGAACATTGAGATCGTTTTCGTTCTTCTCTTCGGCAACATCAACGCCG
ACGCCAGGCGCGAGTGCGGTAAACGGGCAGTCAGCTGCTGGTAGTCCTGCCCCTGCGTTCCAGGATCATGTCAGA
AGTGCTTCTGTAACGGCGTCTACAGCGGCTTCTGCTGCAGCGACCAACTTGACGACTTGGGGTGCTGGGATTGGA
TCGTTTTTCTCGTCAAAGTTGGCGAGGACTAAATCGACTGATGCTACTGCTACCCCCACTCGACAGCAGCAGCAG
CAGGAGAAACCGTTACCACCTAGTGCTGTGGATTTGAAATCTTCGACTTCACTTCCTCCTTTACCTTCTTTGGTT
ACACAGTCGCCCGTGACATCGACTTCGGCTAGTTTTAGAGATTCGGACTCAGGAACTATATTTTCAGCGACATCG
CCAACGACTACGGTACCTATCACGCATAAGGCGACTATTGCTGGAGAGGCGCGTGTGGTATCAATGACGACGGCG
ACTACTCCGTTGAAGGAAAGTAGAAGGAGTGTTGAGAAGAAAGCAAATGTGGTTGAAGATGAAGTTTCGGATGGG
GCGGGTGAGACGGTGTATAGTGGTGTGGCGTTGTAG
Gene >Agabi119p4|104000
ATGGAACCACCGCCGACAGCTGCTGCACACAGCCAGCCAGACCACGACTCGGACGCAGACACCGCCTCCCAACGC
TCCATCTCCCTCGATTCCCCGCCCCTGTCTCCCAGGACAGATGCCCGCGACTTTCTCGCGAACCCAGGCGCCTTT
CTCCGCTCGGACGACAAGCGCGAGTCCAACCAGTTCACCGTCGACACAGACTTTAGTTCGGACACAGACGACATG
AGCATGCACAAGCATAGAGCGTCTGTCGTTGCAGAGTCGCCAAACACCACCGCTCCACCCTCGATATTCGAAGAG
GAGCCACTAACAGCGACAAAGCAGTCCATCAATGGTCTTGTGGATTCACAACCGTCGTCTTCGCTTCCAACCCCC
ATGGCAACAACGTATCCACCCACCCCTTCAGCACACGACGACACTATTTCGATATCTTCCCTGACATCAAACACG
TCTTCTCGCAAAGCTCGGCCTGAGTCTCTTCTCGTGAGTCCTCCAGAAGGGCCTCTAGTGCTGGGCATCGCCCTG
GTCGACTTTAATCACCTGGTCAGTCATTCGTTTTCATTCCAGAACATAAACTCATGCAGCTCACAGGTTGGCCCT
CGCATAGAGTGGTCAAAAGGTGATATTTTTAATGATGAAGAGGTTGCCAAAATACTGCCTTTCCTTGCCCTCCCT
GACGGTGCCCATCTCGTCAGTCTTTCTGTCATTTTTACCTCGATGTCTCCTGAAAACTCGTTTAGTCAACCGAAG
ACTACTCGTATTTCCACCTTGTGCCTCCCGGTCTCAATACCACAACTATTTTTGGCATCTCGCAAGTCTGATTAT
CGAACAAGATTTGTATCATGGCCTTATATGCATTCTGATTCTTAGATGCAATCAACAAATCGCTTCAAAATTATT
ACTCGTCAAAGACCCCGATGTCACTCGTTCGATAGTCCAAAAAGCGGTGGTCGTTTTGGCCTCCAAACCCGTTTT
TGGCCCAATTAGGTATGCTCACTCCCTTTGACGGCGAATCAATTGTATAGACCAGACCACCCATTATAGGGACAA
GTTGCGGGTAGTGACAACGGCTCTCTTTCAGCAAAGGTGCGTTAATAGAATATCCTGACATACATACTTGTAGCT
CATACATCTACAGAGACTTTACGGATATTAGTATATTGGATATTTTCGCCGTCAATTTGGAACCAAGTTTAAGAG
GACAATTGACGGAAAGCGGGTTGTATATGGGTGTGTGACGCGCCTTTCTCTTGATAATGTCTTCTCAATAATTCT
ACAGGTACAAGTCTGTGCGTGCCTTCCACATATCCACAGCGTTGTTTAATTATACTTGATTAGCCGTGAATTTGT
GCATACCTTCCGGCATCGTACTCTTATCCTTGTCAAAGCATTAATACTTCAGAAGAGGGTGAGCTTTACTCTGCT
GGGTGTATGCTTGAATCTGACTGCTCGAAGATCATGTTTTATGGTCATCCCGTAGAACGACTATGTACATATCAA
TATTCCCTAATATCATTGATACCCGGTAAACGTCTCTGCTCCCTTCAATCAATGCTTTTCTGATACCTCCGCTAG
GTTTATTACAACATCTGGAAGATTGTGGCTCCCCACCGCTCTCTAATAGAGCACCGACTCTTTCACGGCCTAATT
CTTTGAAGACTTCCGACCATAAGAGCATGATGGCTTTTATGGGGATGCCGCTAGACGTATTTGGCAAGGTAATGT
CTACTAGTATGGCATCTAAATCACTTGACCCATTGAGTTTTTTTTTTTTGAATTCAGGATGCATTTTTCCAACCC
TATCTTCCGCTCCAGCAGCTGGATATGCTGGTGGGAACGCCTAGCTGGTTGTGTGGGAGCACGAATTCGATTGTG
ACCCAACAAAAGGAAATCGATTTATTTGTGGATGTACGTCCGAGAGTACTCTTTTATTGACAAATTTCTTTGTGG
CTCATTGGATTGTCAGACCGAAACTGGGATGATTGAGATTCGTGATCCAAGATTAGAACGTTCGGTGGCGTTGAC
CGCGGCAGACCGTAAATGGATGGATGATATCGTGAACGATGTTAATGCGAATTGGGATGATGAGGATCCGGGCAG
GGCGTCAAGCATGCAGTGCGTCATTCCACTCTGTCTTACTCGTGAATAGCTAAGTCGTTGACTGAAGAACTAGGT
TCAAAGGGAGCGATGATTATCTAAGGACCAAAGTGCGTTGATCCATTCTGTCTGGTTACGAGTGCTAATATATGT
GGATAGTTTGAGGAGTATATCTCGGCTGCGTTGTCGTCCGTCAAGTACCGAGACTTCGTAGCGAAAGGTGAAGGA
AATGGCGTATTGATCACTGGTGGAACTGGTATGTTCTTGTCGCTTATTGGTTGTACAGTCCAACTCTGACGACTA
TCTGTTTAGGTGGTGATGTGGCGAGCATGGAGGATTTCAATTCTTTATGGATATCTGAATTCCGAGGTACCAATG
CATATGCAGTCTGGGACCGCATTACAGATCCAGTAATTTTTGACATCATTGAACCTCGGTGAGCATATTCCTTAT
TTTCACCAGCACCGGCATAGATTGATACGTGCATAGACACCCATGTACAGATAAACCATCGGTCGTATCAGATCT
AGGTTTACGACTACACGAAGGTATTCAAGATCTCAAACTTGATCAACAACTGGCACCTGCTCGAGAAGCCGTGGC
TAGGACATTCGCTACTGGGTCAACGAATTTCTTCAAAGCCGTAGAAGGGGTAAAAGGACGATGGCGACAGCCAAG
TGCTGGTTCGATACATACTACTACCAGTGCGACAGCTTCCACGGATGATTCGGGTTTGAGTACACCCATTGAGGT
GTCCAAATCGGATTTCGAACCTCAACATGATAAGGGAGGAAGGCCGGATGTGGTAGGGTCTCCACAATCGGGAAC
ATTGAGATCGTTTTCGTTCTTCTCTTCGGCAACATCAACGCCGACGCCAGGCGCGAGTGCGGTAAACGGGCAGTC
AGCTGCTGGTAGTCCTGCCCCTGCGTTCCAGGATCATGTCAGAAGTGCTTCTGTAACGGCGTCTACAGCGGCTTC
TGCTGCAGCGACCAACTTGACGACTTGGGGTGCTGGGATTGGATCGTTTTTCTCGTCAAAGTTGGCGAGGACTAA
ATCGACTGATGCTACTGCTACCCCCACTCGACAGCAGCAGCAGCAGGAGAAACCGTTACCACCTAGTGCTGTGGA
TTTGAAATCTTCGACTTCACTTCCTCCTTTACCTTCTTTGGTTACACAGTCGCCCGTGACATCGACTTCGGCTAG
TTTTAGAGATTCGGACTCAGGAACTATATTTTCAGCGACATCGCCAACGACTACGGTACCTATCACGCATAAGGC
GACTATTGCTGGAGAGGCGCGTGTGGTATCAATGACGACGGCGACTACTCCGTTGAAGGAAAGTAGAAGGAGTGT
TGAGAAGAAAGCAAATGTGGTTGAAGATGAAGTTTCGGATGGGGCGGGTGAGACGGTGTATAGTGGTGTGGCGTT
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail