Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103950
Gene name
Locationscaffold_07:1613521..1616349
Strand+
Gene length (bp)2828
Transcript length (bp)2652
Coding sequence length (bp)2652
Protein length (aa) 884

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07738 Sad1_UNC Sad1 / UNC-like C-terminal 4.2E-25 178 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59729|SLPI_SCHPO Uncharacterized protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.09 PE=3 SV=1 161 309 5.0E-41
sp|Q12232|SLP1_YEAST Uncharacterized protein SLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLP1 PE=1 SV=1 161 324 5.0E-35
sp|Q54MI3|SUN2_DICDI SUN domain-containing protein 2 OS=Dictyostelium discoideum GN=sun2 PE=3 SV=1 160 308 3.0E-31
sp|Q8C341|SUCO_MOUSE SUN domain-containing ossification factor OS=Mus musculus GN=Suco PE=1 SV=3 160 321 4.0E-29
sp|Q9UBS9|SUCO_HUMAN SUN domain-containing ossification factor OS=Homo sapiens GN=SUCO PE=1 SV=1 160 321 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59729|SLPI_SCHPO Uncharacterized protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.09 PE=3 SV=1 161 309 5.0E-41
sp|Q12232|SLP1_YEAST Uncharacterized protein SLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLP1 PE=1 SV=1 161 324 5.0E-35
sp|Q54MI3|SUN2_DICDI SUN domain-containing protein 2 OS=Dictyostelium discoideum GN=sun2 PE=3 SV=1 160 308 3.0E-31
sp|Q8C341|SUCO_MOUSE SUN domain-containing ossification factor OS=Mus musculus GN=Suco PE=1 SV=3 160 321 4.0E-29
sp|Q9UBS9|SUCO_HUMAN SUN domain-containing ossification factor OS=Homo sapiens GN=SUCO PE=1 SV=1 160 321 4.0E-29
sp|Q710E6|SUCO_RAT SUN domain-containing ossification factor OS=Rattus norvegicus GN=Suco PE=2 SV=1 160 321 8.0E-29
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103950
MLESGCCAKLHKPLSPIIVVLLLVWVAFATAESAESTSYNDPCRVISLSAPKPAEPPMCYLKPLRLLEPVQEDLL
LSFEEWKAKQHHGAETGPPAGVTSDNGSEVGDGMGNGSKPPKAEDASSIRSSGQEVHQSQASGRSKESPPHPSPQ
FPVPIVPIVDRFNYASLDCSARVHKAHKEAKHSSNILSSKKDRYLLSPCKTKEPQFVIIELCEDIRVDVVELANF
EFFSGVFKDVTVSVAKTSWEEARWTVLGTWKAKNVRGIQTFRPPIPLKGFYRYLRIDFHSHYGSEYYCPVSLVAV
YGFTHLEEWNWELYEAERTKLDAISPEASIHQTPDSAKTDSAGAIFGQETTLPTDSPEEDVIPSTLLTKILQPST
DPHILPPFIITQFYDFEAPYVAPSSTKTSTSSPTPFSATYHPTASPSSARISPASHPNTANTITSSPVETNVLPT
CTTSSTVLMSTPVSGSQGSLPLSVSGGESIFRTIMNRVLELESNHTLYEQYMAQQQFLVREALKRLGEDIGRLEG
VGKAHRQIHDRATQEWEKQRKRWQFEHAQLLQRIDYLTDEIIMEKRLGVAQLCLLLAVLVFMGLTRGSRGPIDAD
RRRWGTALKSFSDDWRHRRTESGTDGSHVRTLSSMLPVIPLRSAESGSNHSSGEIYEKISSATPPLTSIDLNILS
HHDQRQQRRRGRGDHGSENVQNVYLQVDGGSRSRSRTTSGPRRRTSSRIRGQGSTSRQALETRHSRAPSVANTPT
KGVRASPTVGSIRLNVYDSKRGDSVRRSHSSQGTIDLALEEAWGGSRGNGKSARTWARTAHLHEVKQKRQRNNSG
SLFSGSINGDKHSEYSESTKDNDSDVFGGTEKPELLVTNTAGVETDADGWESASDVEY*
Coding >Agabi119p4|103950
ATGCTCGAGTCCGGATGTTGTGCAAAACTGCACAAACCTCTCTCACCGATAATCGTCGTCCTCTTGCTCGTATGG
GTCGCGTTTGCCACTGCTGAATCTGCTGAATCTACCTCTTATAATGACCCATGTCGTGTAATTTCTCTAAGTGCC
CCAAAGCCTGCCGAGCCTCCGATGTGCTACTTGAAACCGCTAAGGCTCCTGGAACCGGTCCAGGAAGACCTACTG
CTCTCTTTCGAAGAATGGAAGGCTAAACAGCACCATGGAGCCGAGACTGGCCCTCCAGCTGGCGTGACAAGCGAC
AATGGAAGTGAGGTTGGAGACGGTATGGGGAATGGTAGTAAACCACCAAAGGCAGAAGATGCGTCGTCGATACGG
TCTTCGGGCCAGGAGGTCCATCAGTCCCAAGCGTCTGGTCGATCAAAAGAAAGCCCACCTCATCCTTCACCTCAG
TTCCCGGTACCTATTGTACCTATAGTCGATCGCTTCAACTACGCATCGTTGGATTGTTCTGCACGGGTCCACAAG
GCTCACAAAGAGGCGAAACATTCATCGAATATCTTGTCCTCGAAGAAAGACCGTTACTTGCTGAGCCCTTGCAAG
ACGAAGGAACCGCAATTCGTCATCATCGAATTATGCGAGGACATCCGAGTTGATGTCGTGGAACTGGCGAATTTC
GAGTTCTTCAGCGGGGTGTTCAAGGACGTCACAGTCAGCGTCGCGAAGACATCTTGGGAAGAAGCAAGGTGGACG
GTCCTGGGCACTTGGAAGGCGAAAAATGTGAGGGGAATTCAGACCTTTCGCCCACCGATTCCACTAAAAGGATTC
TATCGGTACCTTCGGATCGATTTTCACTCGCATTATGGGTCAGAATACTACTGCCCTGTCTCTTTGGTCGCAGTT
TACGGATTCACGCATCTCGAGGAGTGGAACTGGGAATTATATGAAGCGGAGAGGACTAAATTAGACGCAATATCA
CCAGAGGCTTCTATTCATCAGACACCAGATTCGGCCAAAACCGATAGCGCAGGAGCCATATTTGGCCAAGAGACC
ACTCTACCAACCGACTCTCCAGAGGAGGATGTAATCCCCTCAACCCTGCTTACCAAAATTCTGCAACCCTCCACC
GATCCTCACATCTTACCTCCGTTTATCATTACACAGTTCTATGATTTCGAGGCTCCTTACGTTGCTCCGTCAAGC
ACCAAGACATCCACATCTTCTCCAACACCTTTCTCAGCGACATACCATCCAACAGCCTCCCCATCCAGCGCCCGT
ATATCACCAGCGTCTCATCCTAACACAGCAAACACAATCACGAGTTCGCCCGTTGAAACAAATGTGCTACCGACC
TGTACCACTTCTTCCACTGTCCTAATGTCGACCCCGGTTTCCGGTTCCCAAGGTTCTCTCCCATTATCGGTCTCC
GGTGGAGAGTCCATCTTTCGCACCATTATGAATAGAGTACTGGAATTGGAAAGCAATCACACACTATACGAGCAG
TATATGGCACAACAGCAATTCCTTGTACGCGAAGCATTGAAACGATTAGGCGAAGACATCGGACGGCTTGAAGGC
GTGGGAAAGGCTCACCGACAAATACATGATCGAGCAACACAAGAATGGGAAAAACAGCGGAAAAGATGGCAGTTC
GAACATGCACAACTCCTTCAGCGAATAGACTATTTGACTGATGAGATCATCATGGAAAAGCGTCTGGGAGTCGCC
CAGCTTTGCTTGTTACTCGCTGTTCTGGTGTTCATGGGCCTGACGCGTGGCTCTCGGGGACCAATTGATGCGGAC
CGACGGCGTTGGGGGACCGCGCTCAAGAGTTTCAGTGATGATTGGCGTCATCGGAGAACAGAGTCTGGAACTGAT
GGAAGCCATGTCAGGACTCTGTCATCAATGCTTCCGGTCATACCATTACGATCTGCGGAGTCTGGCTCGAATCAC
TCTTCAGGTGAAATCTACGAAAAAATCTCATCTGCTACACCCCCCCTCACAAGCATCGACTTAAATATCCTCTCT
CATCATGATCAACGACAACAGAGACGCCGTGGCCGTGGGGATCACGGGTCGGAAAACGTGCAGAACGTTTACCTT
CAAGTAGATGGTGGCTCGCGCAGTCGATCTCGGACAACATCCGGACCCCGTCGCCGGACTTCCTCCCGGATTCGA
GGTCAAGGGTCAACTTCTCGACAAGCCTTAGAAACACGTCATAGTCGTGCACCTAGTGTTGCGAATACACCAACA
AAAGGCGTTAGAGCCAGTCCCACGGTGGGATCCATCAGGCTCAACGTTTATGACTCGAAGCGTGGGGATTCAGTG
CGAAGATCTCATTCGAGTCAAGGGACTATTGACCTTGCTCTTGAAGAAGCCTGGGGTGGATCAAGAGGTAATGGT
AAAAGTGCGCGTACATGGGCTAGAACTGCCCATTTACATGAAGTGAAGCAGAAGCGGCAACGGAATAATTCAGGG
TCTTTGTTCAGTGGTAGCATTAACGGTGATAAGCACTCGGAATATTCAGAAAGTACAAAAGACAATGACTCGGAC
GTGTTTGGTGGCACTGAAAAGCCGGAATTGTTGGTTACAAATACTGCGGGTGTGGAAACTGATGCTGATGGTTGG
GAAAGTGCTAGTGATGTAGAATATTGA
Transcript >Agabi119p4|103950
ATGCTCGAGTCCGGATGTTGTGCAAAACTGCACAAACCTCTCTCACCGATAATCGTCGTCCTCTTGCTCGTATGG
GTCGCGTTTGCCACTGCTGAATCTGCTGAATCTACCTCTTATAATGACCCATGTCGTGTAATTTCTCTAAGTGCC
CCAAAGCCTGCCGAGCCTCCGATGTGCTACTTGAAACCGCTAAGGCTCCTGGAACCGGTCCAGGAAGACCTACTG
CTCTCTTTCGAAGAATGGAAGGCTAAACAGCACCATGGAGCCGAGACTGGCCCTCCAGCTGGCGTGACAAGCGAC
AATGGAAGTGAGGTTGGAGACGGTATGGGGAATGGTAGTAAACCACCAAAGGCAGAAGATGCGTCGTCGATACGG
TCTTCGGGCCAGGAGGTCCATCAGTCCCAAGCGTCTGGTCGATCAAAAGAAAGCCCACCTCATCCTTCACCTCAG
TTCCCGGTACCTATTGTACCTATAGTCGATCGCTTCAACTACGCATCGTTGGATTGTTCTGCACGGGTCCACAAG
GCTCACAAAGAGGCGAAACATTCATCGAATATCTTGTCCTCGAAGAAAGACCGTTACTTGCTGAGCCCTTGCAAG
ACGAAGGAACCGCAATTCGTCATCATCGAATTATGCGAGGACATCCGAGTTGATGTCGTGGAACTGGCGAATTTC
GAGTTCTTCAGCGGGGTGTTCAAGGACGTCACAGTCAGCGTCGCGAAGACATCTTGGGAAGAAGCAAGGTGGACG
GTCCTGGGCACTTGGAAGGCGAAAAATGTGAGGGGAATTCAGACCTTTCGCCCACCGATTCCACTAAAAGGATTC
TATCGGTACCTTCGGATCGATTTTCACTCGCATTATGGGTCAGAATACTACTGCCCTGTCTCTTTGGTCGCAGTT
TACGGATTCACGCATCTCGAGGAGTGGAACTGGGAATTATATGAAGCGGAGAGGACTAAATTAGACGCAATATCA
CCAGAGGCTTCTATTCATCAGACACCAGATTCGGCCAAAACCGATAGCGCAGGAGCCATATTTGGCCAAGAGACC
ACTCTACCAACCGACTCTCCAGAGGAGGATGTAATCCCCTCAACCCTGCTTACCAAAATTCTGCAACCCTCCACC
GATCCTCACATCTTACCTCCGTTTATCATTACACAGTTCTATGATTTCGAGGCTCCTTACGTTGCTCCGTCAAGC
ACCAAGACATCCACATCTTCTCCAACACCTTTCTCAGCGACATACCATCCAACAGCCTCCCCATCCAGCGCCCGT
ATATCACCAGCGTCTCATCCTAACACAGCAAACACAATCACGAGTTCGCCCGTTGAAACAAATGTGCTACCGACC
TGTACCACTTCTTCCACTGTCCTAATGTCGACCCCGGTTTCCGGTTCCCAAGGTTCTCTCCCATTATCGGTCTCC
GGTGGAGAGTCCATCTTTCGCACCATTATGAATAGAGTACTGGAATTGGAAAGCAATCACACACTATACGAGCAG
TATATGGCACAACAGCAATTCCTTGTACGCGAAGCATTGAAACGATTAGGCGAAGACATCGGACGGCTTGAAGGC
GTGGGAAAGGCTCACCGACAAATACATGATCGAGCAACACAAGAATGGGAAAAACAGCGGAAAAGATGGCAGTTC
GAACATGCACAACTCCTTCAGCGAATAGACTATTTGACTGATGAGATCATCATGGAAAAGCGTCTGGGAGTCGCC
CAGCTTTGCTTGTTACTCGCTGTTCTGGTGTTCATGGGCCTGACGCGTGGCTCTCGGGGACCAATTGATGCGGAC
CGACGGCGTTGGGGGACCGCGCTCAAGAGTTTCAGTGATGATTGGCGTCATCGGAGAACAGAGTCTGGAACTGAT
GGAAGCCATGTCAGGACTCTGTCATCAATGCTTCCGGTCATACCATTACGATCTGCGGAGTCTGGCTCGAATCAC
TCTTCAGGTGAAATCTACGAAAAAATCTCATCTGCTACACCCCCCCTCACAAGCATCGACTTAAATATCCTCTCT
CATCATGATCAACGACAACAGAGACGCCGTGGCCGTGGGGATCACGGGTCGGAAAACGTGCAGAACGTTTACCTT
CAAGTAGATGGTGGCTCGCGCAGTCGATCTCGGACAACATCCGGACCCCGTCGCCGGACTTCCTCCCGGATTCGA
GGTCAAGGGTCAACTTCTCGACAAGCCTTAGAAACACGTCATAGTCGTGCACCTAGTGTTGCGAATACACCAACA
AAAGGCGTTAGAGCCAGTCCCACGGTGGGATCCATCAGGCTCAACGTTTATGACTCGAAGCGTGGGGATTCAGTG
CGAAGATCTCATTCGAGTCAAGGGACTATTGACCTTGCTCTTGAAGAAGCCTGGGGTGGATCAAGAGGTAATGGT
AAAAGTGCGCGTACATGGGCTAGAACTGCCCATTTACATGAAGTGAAGCAGAAGCGGCAACGGAATAATTCAGGG
TCTTTGTTCAGTGGTAGCATTAACGGTGATAAGCACTCGGAATATTCAGAAAGTACAAAAGACAATGACTCGGAC
GTGTTTGGTGGCACTGAAAAGCCGGAATTGTTGGTTACAAATACTGCGGGTGTGGAAACTGATGCTGATGGTTGG
GAAAGTGCTAGTGATGTAGAATATTGA
Gene >Agabi119p4|103950
ATGCTCGAGTCCGGATGTTGTGCAAAACTGCACAAACCTCTCTCACCGATAATCGTCGTCCTCTTGCTCGTATGG
GTCGCGTTTGCCACTGCTGAATCTGCTGAATCTACCTCTTATAATGACCCATGTCGTGTAATTTCTCTAAGTGCC
CCAAAGCCTGCCGAGCCTCCGATGTGCTACTTGAAACCGCTAAGGCTCCTGGAACCGGTCCAGGAAGACCTACTG
CTCTCTTTCGAAGAATGGAAGGCTAAACAGCACCATGGAGCCGAGACTGGCCCTCCAGCTGGCGTGACAAGCGAC
AATGGAAGTGAGGTTGGAGACGGTATGGGGAATGGTAGTAAACCACCAAAGGCAGAAGATGCGTCGTCGATACGG
TCTTCGGGCCAGGAGGTCCATCAGTCCCAAGCGTCTGGTCGATCAAAAGAAAGCCCACCTCATCCTTCACCTCAG
TTCCCGGTACCTATTGTACCTATAGTCGATCGCTTCAACTACGCATCGTTGGATTGTTCTGCACGGGTCCACAAG
GCTCACAAAGAGGCGAAACATTCATCGAATATCTTGTCCTCGAAGAAAGACCGTTACTTGCTGAGCCCTTGCAAG
ACGAAGGAACCGCAATTCGTCATCATCGAATTATGCGAGGACATCCGAGTTGATGTCGTGGAACTGGCGAATTTC
GAGTTCTTCAGCGGGGTGTTCAAGGACGTCACAGTCAGCGTCGCGAAGACATCTTGGGAAGAAGCAAGGTGGACG
GTCCTGGGCACTTGGAAGGCGAAAAATGTGAGGGGAATTCAGGTGTGTCTGTCTATGTAGCTTCTACATTGTGTG
TGAGCTTACTCTATTAGACCTTTCGCCCACCGATTCCACTAAAAGGATTCTATCGGTACCTTCGGATCGATTTTC
ACTCGCATTATGGGTCAGAATACTACTGCCCTGTCTCTTTGGTCGCAGTTTACGGATTCACGCATCTCGAGGAGT
GGAACTGGGAATTATATGAAGCGGAGAGGACTAAATTAGACGCAATATCACCAGAGGCTTCTATTCATCAGACAC
CAGATTCGGCCAAAACCGATAGCGCAGGAGCCATATTTGGCCAAGAGACCACTCTACCAACCGACTCTCCAGAGG
AGGATGTAATCCCCTCAACCCTGCTTACCAAAATTCTGCAACCCTCCACCGATCCTCACATCTTACCTCCGTTTA
TCATTACACAGTTCTATGATTTCGAGGCTCCTTACGTTGCTCCGTCAAGCACCAAGACATCCACATCTTCTCCAA
CACCTTTCTCAGCGACATACCATCCAACAGCCTCCCCATCCAGCGCCCGTATATCACCAGCGTCTCATCCTAACA
CAGCAAACACAATCACGAGTTCGCCCGTTGAAACAAATGTGCTACCGACCTGTACCACTTCTTCCACTGTCCTAA
TGTCGACCCCGGTTTCCGGTTCCCAAGGTTCTCTCCCATTATCGGTCTCCGGTGGAGAGTCCATCTTTCGCACCA
TTATGAATAGAGTACTGGAATTGGAAAGCAATCACACACTATACGAGCAGTATATGGCACAACAGCAATTCCTTG
TACGCGAAGCATTGAAACGATTAGGCGAAGACATCGGACGGCTTGAAGGCGTGGTTCGTTGCTTCACGATTCCTC
AGAATTTTTACCAATTTAAAGATGTTTCTTTATTAATCAGGGAAAGGCTCACCGACAAATACATGATCGAGCAAC
ACAAGAATGGGAAAAACAGCGGAAAAGATGGCAGTTCGAACATGCACAACTCCTTCAGCGAATAGACTATTTGAC
TGATGAGGTAAATGACTCGAATTTATCGGCCAATTACCTGCCTTGTTCACAGATCCTGCTTTATCATTCAGATCA
TCATGGAAAAGCGTCTGGGAGTCGCCCAGCTTTGCTTGTTACTCGCTGTTCTGGTGTTCATGGGCCTGACGCGTG
GCTCTCGGGGACCAATTGATGCGGACCGACGGCGTTGGGGGACCGCGCTCAAGAGTTTCAGTGATGATTGGCGTC
ATCGGAGAACAGAGTCTGGAACTGATGGAAGCCATGTCAGGACTCTGTCATCAATGCTTCCGGTCATACCATTAC
GATCTGCGGAGTCTGGCTCGAATCACTCTTCAGGTGAAATCTACGAAAAAATCTCATCTGCTACACCCCCCCTCA
CAAGCATCGACTTAAATATCCTCTCTCATCATGATCAACGACAACAGAGACGCCGTGGCCGTGGGGATCACGGGT
CGGAAAACGTGCAGAACGTTTACCTTCAAGTAGATGGTGGCTCGCGCAGTCGATCTCGGACAACATCCGGACCCC
GTCGCCGGACTTCCTCCCGGATTCGAGGTCAAGGGTCAACTTCTCGACAAGCCTTAGAAACACGTCATAGTCGTG
CACCTAGTGTTGCGAATACACCAACAAAAGGCGTTAGAGCCAGTCCCACGGTGGGATCCATCAGGCTCAACGTTT
ATGACTCGAAGCGTGGGGATTCAGTGCGAAGATCTCATTCGAGTCAAGGGACTATTGACCTTGCTCTTGAAGAAG
CCTGGGGTGGATCAAGAGGTAATGGTAAAAGTGCGCGTACATGGGCTAGAACTGCCCATTTACATGAAGTGAAGC
AGAAGCGGCAACGGAATAATTCAGGGTCTTTGTTCAGTGGTAGCATTAACGGTGATAAGCACTCGGAATATTCAG
AAAGTACAAAAGACAATGACTCGGACGTGTTTGGTGGCACTGAAAAGCCGGAATTGTTGGTTACAAATACTGCGG
GTGTGGAAACTGATGCTGATGGTTGGGAAAGTGCTAGTGATGTAGAATATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail