Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103810
Gene name
Locationscaffold_07:1586771..1587728
Strand+
Gene length (bp)957
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 6.4E-44 7 206
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.2E-32 15 206
PF08659 KR KR domain 2.6E-08 8 127
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.1E-05 8 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M2E2|SDR1_ARATH (+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1 4 207 1.0E-24
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 4 207 6.0E-24
sp|B2X050|MNR1_CAPAN (+)-neomenthol dehydrogenase OS=Capsicum annuum GN=MNR1 PE=1 SV=1 2 206 2.0E-22
sp|P39577|DLTE_BACSU Uncharacterized oxidoreductase DltE OS=Bacillus subtilis (strain 168) GN=dltE PE=3 SV=2 1 221 4.0E-21
sp|A4UHT7|SALR_PAPBR Salutaridine reductase OS=Papaver bracteatum GN=SALR PE=1 SV=1 3 207 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M2E2|SDR1_ARATH (+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1 4 207 1.0E-24
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 4 207 6.0E-24
sp|B2X050|MNR1_CAPAN (+)-neomenthol dehydrogenase OS=Capsicum annuum GN=MNR1 PE=1 SV=1 2 206 2.0E-22
sp|P39577|DLTE_BACSU Uncharacterized oxidoreductase DltE OS=Bacillus subtilis (strain 168) GN=dltE PE=3 SV=2 1 221 4.0E-21
sp|A4UHT7|SALR_PAPBR Salutaridine reductase OS=Papaver bracteatum GN=SALR PE=1 SV=1 3 207 1.0E-20
sp|Q071N0|SALR_PAPSO Salutaridine reductase OS=Papaver somniferum GN=SALR PE=1 SV=1 3 226 2.0E-20
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 6 205 2.0E-20
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 6 205 2.0E-20
sp|Q6WAU1|IPIPR_MENPI (-)-isopiperitenone reductase OS=Mentha piperita PE=1 SV=1 1 207 1.0E-19
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 3 205 3.0E-19
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 5 205 7.0E-19
sp|Q5RCU5|CBR1_PONAB Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3 1 165 1.0E-18
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 1 165 2.0E-18
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 1 203 6.0E-18
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 7 206 8.0E-18
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 7 206 1.0E-17
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 4 205 3.0E-17
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 1 165 7.0E-17
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 7 206 8.0E-17
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 7 207 1.0E-16
sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=1 SV=1 1 205 2.0E-16
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 6 205 2.0E-16
sp|P48758|CBR1_MOUSE Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3 1 148 5.0E-16
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 1 203 5.0E-16
sp|O75828|CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 1 148 5.0E-16
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 9 205 9.0E-16
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 1 206 1.0E-15
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 6 205 2.0E-15
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 6 205 2.0E-15
sp|P50200|HDHA_CLOSO NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 6 203 2.0E-15
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 4 205 4.0E-15
sp|Q3T001|H17B6_BOVIN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Bos taurus GN=HSD17B6 PE=2 SV=1 6 206 4.0E-15
sp|Q28960|CBR1_PIG Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3 1 165 4.0E-15
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 6 203 4.0E-15
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 9 205 5.0E-15
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 6 205 5.0E-15
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 4 205 5.0E-15
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 5 205 8.0E-15
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 6 211 8.0E-15
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 6 207 9.0E-15
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 6 207 1.0E-14
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 7 205 2.0E-14
sp|P37059|DHB2_HUMAN Estradiol 17-beta-dehydrogenase 2 OS=Homo sapiens GN=HSD17B2 PE=1 SV=1 1 199 2.0E-14
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 6 204 2.0E-14
sp|P47844|CBR1_RABIT Carbonyl reductase [NADPH] 1 OS=Oryctolagus cuniculus GN=CBR1 PE=2 SV=2 1 205 2.0E-14
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 1 205 3.0E-14
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 4 205 3.0E-14
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 4 205 3.0E-14
sp|P47727|CBR1_RAT Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus GN=Cbr1 PE=1 SV=2 1 205 3.0E-14
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 7 211 3.0E-14
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 5 214 4.0E-14
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 4 205 4.0E-14
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 4 205 4.0E-14
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 7 207 4.0E-14
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 7 207 5.0E-14
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 4 199 5.0E-14
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 5 222 6.0E-14
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 4 205 6.0E-14
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 4 205 6.0E-14
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 4 205 6.0E-14
sp|Q3SZD7|CBR1_BOVIN Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1 1 132 8.0E-14
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 6 207 8.0E-14
sp|D4AK45|CHADH_ARTBC Chanoclavine-I dehydrogenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04646 PE=1 SV=1 2 198 8.0E-14
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 6 203 1.0E-13
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 5 205 1.0E-13
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 1 206 1.0E-13
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 8 205 1.0E-13
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 8 205 1.0E-13
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 6 205 1.0E-13
sp|O34896|UXUB_BACSU Uncharacterized oxidoreductase UxuB OS=Bacillus subtilis (strain 168) GN=uxuB PE=2 SV=1 6 212 1.0E-13
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 5 205 1.0E-13
sp|Q9P7I6|YJNK_SCHPO Uncharacterized oxidoreductase C24B10.20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.20 PE=3 SV=1 7 205 1.0E-13
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 6 206 1.0E-13
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 6 203 2.0E-13
sp|P05406|FIXR_BRADU Protein FixR OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixR PE=3 SV=2 5 205 3.0E-13
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 6 206 3.0E-13
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 7 206 3.0E-13
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 6 205 3.0E-13
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 6 205 3.0E-13
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 8 199 4.0E-13
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 4 205 4.0E-13
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 6 205 4.0E-13
sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 9 205 5.0E-13
sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus GN=Rdh7 PE=1 SV=1 6 199 5.0E-13
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 1 205 5.0E-13
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 4 205 6.0E-13
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 4 205 6.0E-13
sp|P50203|PHAB_ACISR Acetoacetyl-CoA reductase OS=Acinetobacter sp. (strain RA3849) GN=phaB PE=3 SV=1 5 205 6.0E-13
sp|O14756|H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens GN=HSD17B6 PE=1 SV=1 6 205 6.0E-13
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 6 205 7.0E-13
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 6 222 7.0E-13
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 6 222 7.0E-13
sp|O13908|YF3H_SCHPO Uncharacterized oxidoreductase C22A12.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.17c PE=3 SV=1 1 205 9.0E-13
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 6 204 1.0E-12
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 1 214 1.0E-12
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 6 199 1.0E-12
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 9 205 1.0E-12
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 1 206 1.0E-12
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 9 205 1.0E-12
sp|P9WGT3|FABG_MYCTU 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG1 PE=1 SV=1 6 205 1.0E-12
sp|P9WGT2|FABG_MYCTO 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG1 PE=3 SV=1 6 205 1.0E-12
sp|P0A5Y5|FABG_MYCBO 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG PE=3 SV=1 6 205 1.0E-12
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 7 205 2.0E-12
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 6 206 2.0E-12
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 6 204 2.0E-12
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 1 211 2.0E-12
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 6 205 2.0E-12
sp|Q02338|BDH_HUMAN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=BDH1 PE=1 SV=3 8 199 2.0E-12
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 4 205 2.0E-12
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 6 212 2.0E-12
sp|P40580|BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 6 206 2.0E-12
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 6 207 2.0E-12
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 4 205 2.0E-12
sp|P29147|BDH_RAT D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Bdh1 PE=1 SV=2 6 199 2.0E-12
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 9 205 2.0E-12
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 6 205 2.0E-12
sp|Q80XN0|BDH_MOUSE D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Bdh1 PE=1 SV=2 6 199 3.0E-12
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 6 205 3.0E-12
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 8 205 3.0E-12
sp|P19871|3BHD_COMTE 3-beta-hydroxysteroid dehydrogenase OS=Comamonas testosteroni PE=1 SV=5 6 198 3.0E-12
sp|Q4WZ66|CHADH_ASPFU Chanoclavine-I dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaDH PE=3 SV=1 2 205 3.0E-12
sp|D3J0Z1|CHADH_ASPFM Chanoclavine-I dehydrogenase OS=Neosartorya fumigata GN=fgaDH PE=1 SV=1 2 205 3.0E-12
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 1 199 4.0E-12
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 6 205 4.0E-12
sp|O42866|FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 6 205 4.0E-12
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 5 213 5.0E-12
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 5 213 5.0E-12
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 6 205 5.0E-12
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 9 205 6.0E-12
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 6 210 6.0E-12
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 6 205 6.0E-12
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 7 199 6.0E-12
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 6 206 6.0E-12
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 1 205 9.0E-12
sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 2 203 1.0E-11
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 6 205 1.0E-11
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 1 205 1.0E-11
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 1 205 1.0E-11
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 1 204 1.0E-11
sp|O93868|MTDH_AGABI NADP-dependent mannitol dehydrogenase OS=Agaricus bisporus GN=mtdH PE=1 SV=3 1 203 1.0E-11
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 6 205 1.0E-11
sp|P33368|YOHF_ECOLI Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 6 215 1.0E-11
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 6 205 1.0E-11
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 5 205 1.0E-11
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 2 203 2.0E-11
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 1 205 2.0E-11
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 6 92 2.0E-11
sp|Q56318|Y019_THEMA Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0019 PE=3 SV=2 6 203 2.0E-11
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 9 208 2.0E-11
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 1 205 2.0E-11
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 6 214 2.0E-11
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 6 214 2.0E-11
sp|Q10216|YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.08 PE=3 SV=1 9 205 3.0E-11
sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 1 207 3.0E-11
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 6 222 3.0E-11
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 2 203 3.0E-11
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 6 212 4.0E-11
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 6 207 4.0E-11
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 4 207 4.0E-11
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 6 205 4.0E-11
sp|Q9R092|H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus GN=Hsd17b6 PE=1 SV=1 6 206 5.0E-11
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 2 203 5.0E-11
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 1 205 6.0E-11
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 1 205 6.0E-11
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 6 219 7.0E-11
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 6 219 7.0E-11
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 2 203 8.0E-11
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 6 205 1.0E-10
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 1 206 1.0E-10
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 9 213 1.0E-10
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 6 205 1.0E-10
sp|Q05528|KDUD_DICD3 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 6 203 1.0E-10
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 9 208 1.0E-10
sp|P40579|YIV5_YEAST Uncharacterized oxidoreductase YIR035C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIR035C PE=1 SV=1 6 205 1.0E-10
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 1 208 1.0E-10
sp|Q3U0B3|DHR11_MOUSE Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 6 207 1.0E-10
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 2 223 2.0E-10
sp|O54753|H17B6_RAT 17-beta-hydroxysteroid dehydrogenase type 6 OS=Rattus norvegicus GN=Hsd17b6 PE=1 SV=2 6 206 3.0E-10
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 6 205 3.0E-10
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 9 205 3.0E-10
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 6 205 3.0E-10
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 6 205 3.0E-10
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 4 211 4.0E-10
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 6 205 4.0E-10
sp|O14351|YB45_SCHPO Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC30D10.05c PE=3 SV=1 3 205 4.0E-10
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 5 204 4.0E-10
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 6 205 5.0E-10
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 2 205 5.0E-10
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 4 199 5.0E-10
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 6 208 5.0E-10
sp|Q9BPW9|DHRS9_HUMAN Dehydrogenase/reductase SDR family member 9 OS=Homo sapiens GN=DHRS9 PE=1 SV=1 4 205 6.0E-10
sp|Q8HYR6|DHRS9_BOVIN Dehydrogenase/reductase SDR family member 9 OS=Bos taurus GN=DHRS9 PE=2 SV=1 4 206 6.0E-10
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 7 205 6.0E-10
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 2 199 6.0E-10
sp|Q8AVY8|DH12B_XENLA Very-long-chain 3-oxoacyl-CoA reductase-B OS=Xenopus laevis GN=hsd17b12-b PE=2 SV=1 2 205 6.0E-10
sp|Q7Z4W1|DCXR_HUMAN L-xylulose reductase OS=Homo sapiens GN=DCXR PE=1 SV=2 6 205 6.0E-10
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 4 199 7.0E-10
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 5 205 7.0E-10
sp|Q5XG41|DH12A_XENLA Very-long-chain 3-oxoacyl-CoA reductase-A OS=Xenopus laevis GN=hsd17b12-a PE=2 SV=1 9 205 7.0E-10
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 6 204 7.0E-10
sp|Q58NB6|DHRS9_MOUSE Dehydrogenase/reductase SDR family member 9 OS=Mus musculus GN=Dhrs9 PE=2 SV=2 6 205 8.0E-10
sp|P56937|DHB7_HUMAN 3-keto-steroid reductase OS=Homo sapiens GN=HSD17B7 PE=1 SV=1 5 207 8.0E-10
sp|Q920P0|DCXR_RAT L-xylulose reductase OS=Rattus norvegicus GN=Dcxr PE=1 SV=1 6 205 8.0E-10
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 6 206 8.0E-10
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 6 206 8.0E-10
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 6 206 8.0E-10
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 6 205 1.0E-09
sp|P50202|MAS1_AGRT9 Agropine synthesis reductase OS=Agrobacterium tumefaciens (strain 15955) GN=mas1 PE=3 SV=1 7 211 1.0E-09
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 1 200 1.0E-09
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 1 200 1.0E-09
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 1 200 1.0E-09
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 1 200 1.0E-09
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 1 200 1.0E-09
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 1 200 1.0E-09
sp|Q8JIS3|DER_CHICK D-erythrulose reductase OS=Gallus gallus GN=DER PE=1 SV=1 1 205 1.0E-09
sp|Q9ZW20|TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 9 215 1.0E-09
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 1 206 1.0E-09
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 6 203 1.0E-09
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 6 203 1.0E-09
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 4 206 1.0E-09
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 4 206 1.0E-09
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 6 205 1.0E-09
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 5 206 2.0E-09
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 5 206 2.0E-09
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 1 206 2.0E-09
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 6 108 2.0E-09
sp|P50201|MAS12_AGRRH Agropine synthesis reductase OS=Agrobacterium rhizogenes GN=mas1 PE=3 SV=1 7 206 2.0E-09
sp|P50842|KDUD_BACSU 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) GN=kduD PE=2 SV=1 1 203 2.0E-09
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 7 213 2.0E-09
sp|O31642|YJDA_BACSU Uncharacterized oxidoreductase YjdA OS=Bacillus subtilis (strain 168) GN=yjdA PE=3 SV=1 3 203 2.0E-09
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 7 213 2.0E-09
sp|P23170|25KD_SARPE Development-specific 25 kDa protein OS=Sarcophaga peregrina PE=2 SV=1 8 205 2.0E-09
sp|Q51576|Y3106_PSEAE Uncharacterized oxidoreductase PA3106 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3106 PE=3 SV=1 6 204 2.0E-09
sp|E3VWI6|PNTF_STRAE 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces arenae GN=pntF PE=3 SV=1 1 129 2.0E-09
sp|Q28IU1|DHB12_XENTR Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 9 205 2.0E-09
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 7 213 2.0E-09
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 3 227 2.0E-09
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 6 205 3.0E-09
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 1 206 3.0E-09
sp|O16881|DHS16_CAEEL 3 beta-hydroxysteroid dehydrogenase dhs-16 OS=Caenorhabditis elegans GN=dhs-16 PE=2 SV=1 1 205 3.0E-09
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 6 205 3.0E-09
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 7 213 3.0E-09
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 3 205 3.0E-09
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 3 205 3.0E-09
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 3 205 3.0E-09
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 3 205 3.0E-09
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 3 205 3.0E-09
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 3 205 3.0E-09
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 4 205 3.0E-09
sp|Q9ZW19|TRNHC_ARATH Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 9 205 3.0E-09
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 4 199 3.0E-09
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 1 205 3.0E-09
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 6 205 3.0E-09
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 4 205 4.0E-09
sp|P15047|ENTA_ECOLI 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Escherichia coli (strain K12) GN=entA PE=1 SV=1 1 206 4.0E-09
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 6 205 4.0E-09
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 1 199 4.0E-09
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 2 108 5.0E-09
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 1 206 5.0E-09
sp|G5DGA8|IDLDH_IPSPI Ipsdienol dehydrogenase OS=Ips pini GN=IDOLDH PE=1 SV=1 7 205 5.0E-09
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 6 199 5.0E-09
sp|Q91X52|DCXR_MOUSE L-xylulose reductase OS=Mus musculus GN=Dcxr PE=1 SV=2 6 205 5.0E-09
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 1 205 6.0E-09
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 6 133 6.0E-09
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 6 221 6.0E-09
sp|Q6CEE9|SDR_YARLI Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 1 220 7.0E-09
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 6 199 7.0E-09
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 7 208 9.0E-09
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 1 205 1.0E-08
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 6 204 1.0E-08
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 6 204 1.0E-08
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 1 212 1.0E-08
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 1 212 1.0E-08
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 1 205 1.0E-08
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 5 136 1.0E-08
sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 6 133 1.0E-08
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 6 207 2.0E-08
sp|E3VWK2|PENF_STREX 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces exfoliatus GN=penF PE=3 SV=1 1 129 2.0E-08
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 5 136 2.0E-08
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 6 207 2.0E-08
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 1 213 2.0E-08
sp|Q53882|DNRE_STRS5 Aklaviketone reductase DauE OS=Streptomyces sp. (strain C5) GN=dauE PE=1 SV=1 1 203 2.0E-08
sp|P87218|SOU2_CANAL Sorbose reductase homolog SOU2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU2 PE=3 SV=2 1 220 2.0E-08
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 7 213 2.0E-08
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 7 213 2.0E-08
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 7 205 2.0E-08
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 7 205 2.0E-08
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 7 205 2.0E-08
sp|Q7Z5P4|DHB13_HUMAN 17-beta-hydroxysteroid dehydrogenase 13 OS=Homo sapiens GN=HSD17B13 PE=1 SV=1 2 203 2.0E-08
sp|Q62904|DHB7_RAT 3-keto-steroid reductase OS=Rattus norvegicus GN=Hsd17b7 PE=1 SV=1 5 207 3.0E-08
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 5 206 3.0E-08
sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=1 SV=1 2 203 3.0E-08
sp|P08074|CBR2_MOUSE Carbonyl reductase [NADPH] 2 OS=Mus musculus GN=Cbr2 PE=1 SV=1 9 205 3.0E-08
sp|O02691|HCD2_BOVIN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 7 205 3.0E-08
sp|Q9C826|ABA2_ARATH Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 6 205 4.0E-08
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 6 211 4.0E-08
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 6 206 5.0E-08
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 1 205 5.0E-08
sp|A1L1W4|RD10A_DANRE Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 2 205 5.0E-08
sp|Q9M1K9|ATA1_ARATH Short-chain dehydrogenase reductase ATA1 OS=Arabidopsis thaliana GN=TA1 PE=2 SV=1 5 198 5.0E-08
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 2 205 5.0E-08
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 4 202 5.0E-08
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 6 206 5.0E-08
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 7 199 5.0E-08
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 1 201 5.0E-08
sp|Q29529|CBR2_PIG Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 9 216 5.0E-08
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 6 206 6.0E-08
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 4 209 6.0E-08
sp|P50160|TS2_MAIZE Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1 6 205 6.0E-08
sp|Q9URX0|YLX6_SCHPO Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.06 PE=3 SV=1 1 199 6.0E-08
sp|Q920N9|DCXR_CAVPO L-xylulose reductase OS=Cavia porcellus GN=DCXR PE=2 SV=1 6 205 7.0E-08
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 16 205 7.0E-08
sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 7 205 8.0E-08
sp|D3U1D9|ISFD_KLEOX Sulfoacetaldehyde reductase OS=Klebsiella oxytoca GN=isfD PE=1 SV=1 4 212 8.0E-08
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 4 205 8.0E-08
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 4 199 9.0E-08
sp|Q9ZNN8|BUDC_CORGT L-2,3-butanediol dehydrogenase OS=Corynebacterium glutamicum GN=budC PE=1 SV=1 6 205 1.0E-07
sp|O52384|NAGB_RALSP 1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase OS=Ralstonia sp. GN=nagB PE=3 SV=2 5 205 1.0E-07
sp|Q6NRV4|RD10B_XENLA Retinol dehydrogenase 10-B OS=Xenopus laevis GN=rdh10-b PE=2 SV=1 6 205 1.0E-07
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 6 206 1.0E-07
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 4 205 1.0E-07
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 6 203 1.0E-07
sp|O77667|DHI2_BOVIN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Bos taurus GN=HSD11B2 PE=1 SV=1 1 204 1.0E-07
sp|P44481|Y048_HAEIN Uncharacterized oxidoreductase HI_0048 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0048 PE=1 SV=1 6 213 1.0E-07
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 1 204 1.0E-07
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 9 214 1.0E-07
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 9 214 1.0E-07
sp|P51976|DHI2_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Oryctolagus cuniculus GN=HSD11B2 PE=2 SV=1 1 204 1.0E-07
sp|Q8IZV5|RDH10_HUMAN Retinol dehydrogenase 10 OS=Homo sapiens GN=RDH10 PE=1 SV=1 42 205 1.0E-07
sp|Q8HZT6|RDH10_BOVIN Retinol dehydrogenase 10 OS=Bos taurus GN=RDH10 PE=1 SV=1 42 205 1.0E-07
sp|O32099|BZRD_BACSU Benzil reductase ((S)-benzoin forming) OS=Bacillus subtilis (strain 168) GN=yueD PE=3 SV=1 7 206 1.0E-07
sp|Q8L9C4|KCR1_ARATH Very-long-chain 3-oxoacyl-CoA reductase 1 OS=Arabidopsis thaliana GN=KCR1 PE=1 SV=1 9 206 1.0E-07
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 2 205 1.0E-07
sp|P39333|BDCA_ECOLI Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) GN=bdcA PE=1 SV=2 4 206 1.0E-07
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 8 207 2.0E-07
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 1 205 2.0E-07
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 2 203 2.0E-07
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 7 211 2.0E-07
sp|Q80ZF7|RDH10_RAT Retinol dehydrogenase 10 OS=Rattus norvegicus GN=Rdh10 PE=1 SV=1 2 205 2.0E-07
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 6 206 2.0E-07
sp|Q8VCH7|RDH10_MOUSE Retinol dehydrogenase 10 OS=Mus musculus GN=Rdh10 PE=1 SV=2 42 205 2.0E-07
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 4 199 2.0E-07
sp|F4JZN6|TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 6 203 2.0E-07
sp|P9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 6 206 3.0E-07
sp|P69166|HSD_MYCBO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 6 206 3.0E-07
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 6 225 3.0E-07
sp|Q21929|DCXR_CAEEL L-xylulose reductase OS=Caenorhabditis elegans GN=dhs-21 PE=1 SV=2 3 205 3.0E-07
sp|P25988|ADH_SCAAL Alcohol dehydrogenase OS=Scaptomyza albovittata GN=Adh PE=3 SV=1 1 205 3.0E-07
sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 6 205 3.0E-07
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 6 206 3.0E-07
sp|P9WGT0|HSD_MYCTO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 6 206 4.0E-07
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 2 224 4.0E-07
sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 6 198 4.0E-07
sp|Q93UV4|FLNB_TERSD Fluoren-9-ol dehydrogenase OS=Terrabacter sp. (strain DBF63) GN=flnB PE=1 SV=1 6 201 4.0E-07
sp|P23102|XYLL_PSEPU 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Pseudomonas putida GN=xylL PE=3 SV=1 6 208 4.0E-07
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 6 198 4.0E-07
sp|Q9P324|YI78_SCHPO Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.08 PE=3 SV=1 50 205 4.0E-07
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 6 222 5.0E-07
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 5 205 5.0E-07
sp|P09370|ADH1_DROMO Alcohol dehydrogenase 1 OS=Drosophila mojavensis GN=Adh1 PE=3 SV=3 1 205 5.0E-07
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 6 208 5.0E-07
sp|P51661|DHI2_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Mus musculus GN=Hsd11b2 PE=1 SV=2 1 203 5.0E-07
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 6 205 5.0E-07
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 1 205 5.0E-07
sp|Q92RN6|GALD_RHIME Probable galactose dehydrogenase GalD OS=Rhizobium meliloti (strain 1021) GN=galD PE=3 SV=1 6 204 5.0E-07
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 25 207 6.0E-07
sp|Q5C9I9|ISPD_MENPI (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial OS=Mentha piperita PE=1 SV=1 6 210 7.0E-07
sp|Q13268|DHRS2_HUMAN Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 6 211 7.0E-07
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 7 211 7.0E-07
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 6 207 8.0E-07
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 2 205 8.0E-07
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 6 203 9.0E-07
sp|P19992|HSD_STREX 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 4 205 1.0E-06
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 6 202 1.0E-06
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 6 205 1.0E-06
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 6 207 1.0E-06
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 9 205 1.0E-06
sp|P50168|DHI2_SHEEP Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Ovis aries GN=HSD11B2 PE=2 SV=1 1 204 1.0E-06
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 6 211 1.0E-06
sp|Q9ZW13|TRNH6_ARATH Tropinone reductase homolog At2g29290 OS=Arabidopsis thaliana GN=At2g29290 PE=2 SV=1 9 205 1.0E-06
sp|Q9BPX1|DHB14_HUMAN 17-beta-hydroxysteroid dehydrogenase 14 OS=Homo sapiens GN=HSD17B14 PE=1 SV=1 43 205 1.0E-06
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 6 206 1.0E-06
sp|O34308|YTKK_BACSU Putative oxidoreductase YtkK OS=Bacillus subtilis (strain 168) GN=ytkK PE=3 SV=1 6 199 1.0E-06
sp|B4M8Y0|ADH_DROVI Alcohol dehydrogenase OS=Drosophila virilis GN=Adh1 PE=2 SV=1 1 205 1.0E-06
sp|P9WGQ7|Y1144_MYCTU Uncharacterized oxidoreductase Rv1144 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1144 PE=1 SV=1 1 205 1.0E-06
sp|P9WGQ6|Y1144_MYCTO Uncharacterized oxidoreductase MT1177 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1177 PE=3 SV=1 1 205 1.0E-06
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 6 205 1.0E-06
sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 6 205 1.0E-06
sp|Q00670|ADH_SCACA Alcohol dehydrogenase OS=Scaptomyza crassifemur GN=Adh PE=3 SV=1 5 205 1.0E-06
sp|P80365|DHI2_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Homo sapiens GN=HSD11B2 PE=1 SV=2 1 204 2.0E-06
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 6 206 2.0E-06
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 6 205 2.0E-06
sp|P0C0Y4|MTDH_ALTAL Probable NADP-dependent mannitol dehydrogenase OS=Alternaria alternata PE=1 SV=2 1 211 2.0E-06
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 6 206 2.0E-06
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 9 208 2.0E-06
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 6 204 2.0E-06
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 4 206 2.0E-06
sp|Q7FAE1|MOMAS_ORYSJ Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1 6 205 2.0E-06
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 7 211 2.0E-06
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 7 211 2.0E-06
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 8 207 2.0E-06
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 1 205 3.0E-06
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 8 203 3.0E-06
sp|Q9S9W2|SDRA_ARATH Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 6 208 3.0E-06
sp|Q84ST4|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1 8 213 3.0E-06
sp|Q6DCT3|RD10A_XENLA Retinol dehydrogenase 10-A OS=Xenopus laevis GN=rdh10-a PE=2 SV=1 2 205 3.0E-06
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 6 205 3.0E-06
sp|O08756|HCD2_MOUSE 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus GN=Hsd17b10 PE=1 SV=4 7 205 3.0E-06
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 1 205 4.0E-06
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 6 206 4.0E-06
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 6 202 4.0E-06
sp|P48585|ADH_DROFL Alcohol dehydrogenase OS=Drosophila flavomontana GN=Adh PE=3 SV=2 1 205 4.0E-06
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 6 199 5.0E-06
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 6 199 5.0E-06
sp|P23361|ADH_DROPI Alcohol dehydrogenase OS=Drosophila picticornis GN=Adh PE=3 SV=3 8 205 5.0E-06
sp|P48587|ADH2_DROMN Alcohol dehydrogenase 2 OS=Drosophila montana GN=Adh2 PE=3 SV=2 1 205 5.0E-06
sp|P27874|MAS11_AGRRH Agropine synthesis reductase OS=Agrobacterium rhizogenes GN=mas1 PE=3 SV=2 7 184 5.0E-06
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 6 207 5.0E-06
sp|P10807|ADH_DROLE Alcohol dehydrogenase OS=Drosophila lebanonensis GN=Adh PE=1 SV=1 1 205 5.0E-06
sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 2 227 5.0E-06
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 7 212 5.0E-06
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 4 199 6.0E-06
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 7 211 6.0E-06
sp|Q00671|ADH_DROMM Alcohol dehydrogenase OS=Drosophila mimica GN=Adh PE=3 SV=2 8 205 6.0E-06
sp|P50166|ARDH_CANTR D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida tropicalis GN=ARD PE=1 SV=1 6 205 6.0E-06
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 9 206 6.0E-06
sp|Q9MYP6|DHB14_BOVIN 17-beta-hydroxysteroid dehydrogenase 14 OS=Bos taurus GN=HSD17B14 PE=2 SV=1 62 205 6.0E-06
sp|O70351|HCD2_RAT 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3 7 205 6.0E-06
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 7 133 6.0E-06
sp|P23236|ADH1_DROHY Alcohol dehydrogenase 1 OS=Drosophila hydei GN=Adh1 PE=3 SV=2 1 205 7.0E-06
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 4 205 7.0E-06
sp|P37769|KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 1 203 7.0E-06
sp|O74470|YQC8_SCHPO Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 8 205 7.0E-06
sp|P50167|ARDH_PICST D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARDH PE=2 SV=1 6 205 7.0E-06
sp|P39884|YDFG_DICNO Probable NADP-dependent dehydrogenase in aabA 3'region (Fragment) OS=Dichelobacter nodosus PE=3 SV=1 7 92 7.0E-06
sp|P51552|ADH_ZAPTU Alcohol dehydrogenase OS=Zaprionus tuberculatus GN=Adh PE=3 SV=1 8 205 7.0E-06
sp|Q1QU27|ISFD2_CHRSD Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 7 212 7.0E-06
sp|P12854|ADH1_DRONA Alcohol dehydrogenase 1 OS=Drosophila navojoa GN=Adh1 PE=3 SV=2 1 205 7.0E-06
sp|P27581|ADH2_DROAR Alcohol dehydrogenase 2 OS=Drosophila arizonae GN=Adh2 PE=3 SV=2 1 205 7.0E-06
sp|P25720|ADH2_DROBU Alcohol dehydrogenase 2 OS=Drosophila buzzatii GN=Adh2 PE=3 SV=2 1 205 8.0E-06
sp|Q27404|ADH_DROLA Alcohol dehydrogenase OS=Drosophila lacicola GN=Adh1 PE=3 SV=1 1 205 8.0E-06
sp|P48586|ADH1_DROMN Alcohol dehydrogenase 1 OS=Drosophila montana GN=Adh1 PE=3 SV=2 1 205 8.0E-06
sp|P36086|YKH1_YEAST Uncharacterized oxidoreductase YKL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL071W PE=1 SV=1 1 211 8.0E-06
sp|P23237|ADH2_DROHY Alcohol dehydrogenase 2 OS=Drosophila hydei GN=Adh2 PE=3 SV=2 1 205 9.0E-06
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 6 206 9.0E-06
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 6 206 9.0E-06
sp|P45375|PHBB_ALLVD Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 6 207 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103810
MSTTKRIVLVTGGNAGIGLALCKLIASKGHKVWLAARNPVAGEEAAAKLRQENLDVKTVKLDVTDLSTIVAAKEL
IEKEDGKLDVLVNNAGIGDLDKDQNALTVDLQLIRRAFETNFYGMIQTTQTFVPIIRKAASAAGHAVILNVASDM
ASNSHQAKPDSQLHFVAYNTSKAAANSYTIALSHELRQHNIKVNAVSPGYTSTKLNFFGQDGKDVTGQFMSDSGS
EW*
Coding >Agabi119p4|103810
ATGTCTACAACAAAAAGAATCGTACTTGTAACTGGTGGAAATGCTGGTATTGGACTGGCGTTGTGCAAGTTGATT
GCATCGAAGGGTCACAAAGTATGGTTGGCGGCTAGAAATCCTGTTGCTGGAGAAGAAGCTGCAGCCAAGCTCAGA
CAGGAAAACCTAGACGTGAAGACAGTCAAGCTGGATGTAACAGACTTGAGTACTATCGTCGCTGCAAAGGAGCTT
ATTGAGAAGGAAGACGGTAAATTGGATGTCTTGGTCAACAATGCCGGAATCGGTGACTTGGACAAGGACCAAAAT
GCGCTTACAGTAGATCTACAACTCATCCGAAGAGCTTTTGAGACGAATTTCTACGGGATGATTCAGACCACTCAG
ACGTTTGTTCCAATAATCAGAAAAGCTGCTTCTGCCGCCGGCCATGCAGTCATCTTGAATGTCGCGTCGGACATG
GCGTCCAACTCACATCAGGCGAAGCCGGACAGTCAATTGCACTTCGTGGCCTACAACACCAGCAAAGCCGCTGCA
AACTCGTATACGATTGCGTTATCACACGAGTTGAGGCAACACAACATCAAAGTCAATGCTGTATCGCCTGGTTAT
ACTTCAACCAAGTTGAATTTCTTTGGTCAGGATGGCAAAGATGTGACAGGTCAATTTATGAGTGATTCTGGGTCG
GAGTGGTGA
Transcript >Agabi119p4|103810
ATGTCTACAACAAAAAGAATCGTACTTGTAACTGGTGGAAATGCTGGTATTGGACTGGCGTTGTGCAAGTTGATT
GCATCGAAGGGTCACAAAGTATGGTTGGCGGCTAGAAATCCTGTTGCTGGAGAAGAAGCTGCAGCCAAGCTCAGA
CAGGAAAACCTAGACGTGAAGACAGTCAAGCTGGATGTAACAGACTTGAGTACTATCGTCGCTGCAAAGGAGCTT
ATTGAGAAGGAAGACGGTAAATTGGATGTCTTGGTCAACAATGCCGGAATCGGTGACTTGGACAAGGACCAAAAT
GCGCTTACAGTAGATCTACAACTCATCCGAAGAGCTTTTGAGACGAATTTCTACGGGATGATTCAGACCACTCAG
ACGTTTGTTCCAATAATCAGAAAAGCTGCTTCTGCCGCCGGCCATGCAGTCATCTTGAATGTCGCGTCGGACATG
GCGTCCAACTCACATCAGGCGAAGCCGGACAGTCAATTGCACTTCGTGGCCTACAACACCAGCAAAGCCGCTGCA
AACTCGTATACGATTGCGTTATCACACGAGTTGAGGCAACACAACATCAAAGTCAATGCTGTATCGCCTGGTTAT
ACTTCAACCAAGTTGAATTTCTTTGGTCAGGATGGCAAAGATGTGACAGGTCAATTTATGAGTGATTCTGGGTCG
GAGTGGTGA
Gene >Agabi119p4|103810
ATGTCTACAACAAAAAGAATCGTACTTGTAACTGGTATGTTTCTCTTCAATGGTCCAAGTTCTTGTCTCAATCAA
GTTTTTGGATACATAAAGGTGGAAATGCTGGTATTGGACTGGCGTTGTGCAAGTTGATTGCATCGAAGGGTCACA
AAGTATGGTTGGCGGCTAGAAATCCTGTTGCTGGAGAAGAAGCTGCGTGAGTAGACCAGCAATTCATACGTGCCA
CTGAAGTCCTCAACGACTTGTGATCAGAGCCAAGCTCAGACAGGAAAACCTAGACGTGAAGACAGTCAAGCTGGA
TGTAACAGACTTGAGTACTATCGTCGCTGCAAAGGAGCTTATTGAGAAGGAAGACGGTAAATTGGATGTCTTGGT
CAACAATGCCGGTTGGGTTTATTATCTTATCTTGACTTTAAGCATCGCTAACTCTGGTTCGATAGGAATCGGTGA
CTTGGACAAGGACCAAAATGCGCTTACAGTAGATCTACAACTCATCCGAAGAGCTTTTGAGACGAATTTCTACGG
GATGATTCAGACCACTCAGACGTTTGTTCCAATAATCAGAAAAGCTGCTTCTGCCGCCGGCCATGCAGTCATCTT
GAATGTCGCGTCGGACATGGCGTCCAACTCACATCAGGCGAAGCCGGACAGTCAATTGCACTTCGTGGCCTACAA
CACCAGCAAAGCCGCTGCAAACTCGTATACGATTGCGTTATCACACGAGTTGAGGCAACACAACATCAAAGTCAA
TGCTGTATCGCCTGGTTATACTTCAACCAAGTTGAATTTCTTTGGTCAGGATGGCAAAGATGTGGTAAGCGGGGC
GCAGTGTCTGTTTCCGTGGGCATTGCTCGAGAACGATGGACAGACAGGTGAGTCTTATAACTGACAAAGTGTGCT
GCGGCGACTGACTGCGGTGCAGGTCAATTTATGAGTGATTCTGGGTCGGAGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail