Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|103720
Gene name
Locationscaffold_07:1562497..1569075
Strand-
Gene length (bp)6578
Transcript length (bp)4701
Coding sequence length (bp)4701
Protein length (aa) 1567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14664 RICTOR_N Rapamycin-insensitive companion of mTOR, N-term 8.6E-117 183 558
PF14666 RICTOR_M Rapamycin-insensitive companion of mTOR, middle domain 2.4E-37 765 863
PF14663 RasGEF_N_2 Rapamycin-insensitive companion of mTOR RasGEF_N domain 4.3E-33 870 975
PF04800 NDUS4 NADH dehydrogenase ubiquinone Fe-S protein 4 1.0E-32 1463 1557
PF14668 RICTOR_V Rapamycin-insensitive companion of mTOR, domain 5 1.9E-28 1038 1106

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09743|STE16_SCHPO Protein ste16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste16 PE=3 SV=1 226 1253 0.0E+00
sp|O77203|PIAA_DICDI Protein pianissimo A OS=Dictyostelium discoideum GN=piaA PE=1 SV=1 182 1224 2.0E-123
sp|Q6R327|RICTR_HUMAN Rapamycin-insensitive companion of mTOR OS=Homo sapiens GN=RICTOR PE=1 SV=1 221 1106 5.0E-104
sp|Q6QI06|RICTR_MOUSE Rapamycin-insensitive companion of mTOR OS=Mus musculus GN=Rictor PE=1 SV=2 221 1106 2.0E-102
sp|P40061|TSC11_YEAST Target of rapamycin complex 2 subunit TSC11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSC11 PE=1 SV=1 187 1137 1.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09743|STE16_SCHPO Protein ste16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste16 PE=3 SV=1 226 1253 0.0E+00
sp|O77203|PIAA_DICDI Protein pianissimo A OS=Dictyostelium discoideum GN=piaA PE=1 SV=1 182 1224 2.0E-123
sp|Q6R327|RICTR_HUMAN Rapamycin-insensitive companion of mTOR OS=Homo sapiens GN=RICTOR PE=1 SV=1 221 1106 5.0E-104
sp|Q6QI06|RICTR_MOUSE Rapamycin-insensitive companion of mTOR OS=Mus musculus GN=Rictor PE=1 SV=2 221 1106 2.0E-102
sp|P40061|TSC11_YEAST Target of rapamycin complex 2 subunit TSC11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSC11 PE=1 SV=1 187 1137 1.0E-100
sp|P25711|NDUS4_NEUCR NADH-ubiquinone oxidoreductase 21 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-21 PE=1 SV=2 1445 1566 1.0E-35
sp|P0CB96|NDUS4_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo pygmaeus GN=NDUFS4 PE=2 SV=1 1444 1555 1.0E-23
sp|P0CB95|NDUS4_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo abelii GN=NDUFS4 PE=2 SV=1 1444 1555 1.0E-23
sp|Q02375|NDUS4_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Bos taurus GN=NDUFS4 PE=1 SV=1 1393 1555 2.0E-23
sp|O43181|NDUS4_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens GN=NDUFS4 PE=1 SV=1 1444 1555 1.0E-22
sp|Q0MQH0|NDUS4_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS4 PE=2 SV=1 1444 1555 1.0E-22
sp|Q66XS7|NDUS4_GECJA NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Gecko japonicus GN=NDUFS4 PE=2 SV=1 1399 1555 1.0E-22
sp|Q5XIF3|NDUS4_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Rattus norvegicus GN=Ndufs4 PE=1 SV=1 1451 1555 1.0E-22
sp|Q0MQH1|NDUS4_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pan troglodytes GN=NDUFS4 PE=2 SV=1 1444 1555 1.0E-21
sp|Q9CXZ1|NDUS4_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Mus musculus GN=Ndufs4 PE=1 SV=3 1444 1555 3.0E-21
sp|Q9FJW4|NDUS4_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Arabidopsis thaliana GN=FRO1 PE=2 SV=1 1451 1556 5.0E-16
sp|Q8T1V6|NDUS4_DICDI NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Dictyostelium discoideum GN=ndufs4 PE=3 SV=2 1457 1556 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0022900 electron transport chain Yes
GO:0005747 mitochondrial respiratory chain complex I Yes
GO:0005575 cellular_component No
GO:1990351 transporter complex No
GO:0008152 metabolic process No
GO:0098798 mitochondrial protein-containing complex No
GO:0032991 protein-containing complex No
GO:0098803 respiratory chain complex No
GO:1902495 transmembrane transporter complex No
GO:0098796 membrane protein complex No
GO:0009987 cellular process No
GO:1990204 oxidoreductase complex No
GO:0006091 generation of precursor metabolites and energy No
GO:0044237 cellular metabolic process No
GO:0045271 respiratory chain complex I No
GO:0098800 inner mitochondrial membrane protein complex No
GO:1902494 catalytic complex No
GO:0008150 biological_process No
GO:0030964 NADH dehydrogenase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|103720
MPAQLAFPSQPPSNLSLNSNNNNHRPTNALEILLDSNAEPAKEMERLENLLVREHRILEGAETFLKMELSEISRK
KVESEMAMARKNIMVVNQSLGLLRDRQVTEDAVIQRKRTQESLVMGNGTGVEDRSVEDFRTALQRAHKYFVELDL
LSRSRSHQSAFAAGSSSNDVTASESFEIDRHRVEIMNRIVEIQQRNLRVRYELKLSDVLKSIVPCLADKCSKACR
AAAYRLIRHALVEAESVQRLGTTLDWYIVKSLTRDNKFAVEKEQAIKLVRTIVEVGTTHRDSPVSSGVAVIAISD
AVLRAITAVAENIDDPFRTICIETLTEILLIDIDSLTRTGGLRLLLQVLGDGPPELAPLLAAAFLQIVDSPRTRT
YLRIGCDIEAVLSIITDAYGKGVDHAERMRGCSKVIQLMLHSWSGLMYFAINDMQAIRSVIDTLRIPSLETREVI
LDMFFELLNIKTSDWYQTFISGRRLTMYRKSGVQQDKKSSAPEAQERSHQFVKLTDQFLALLVMVLTKAGLCEAL
TCLLEETRIGSSLSRKATLLLAEILALATRVLPMNAAASIQAIPAVFSMATDYDDGEHRIVGTSALSAIESFNRN
RTRLDNNTALKYTRPRANSVEDPVRRGQRHVEQVKVKMSMQMDDRTFQTAVIETQVMQTKDFTKWNYEALQDVVD
GLMYNQKRLEEVIKARFIRRLMSFYSPFNHRFSDIPRIRDTVKWVKLGCSLLTTLMSGGEGVRYLGNEDQLLSQI
VRGFAQLDPFNGPPDSDPIFSKKRVAETLTYGYFEMLGTLSRYEKGIELLEKFKVFTAFYHLNELRSREDLIKSI
IENLDYSIDGHSRIILSKALTSSYKHIRLYATEHLGSLIRSSITANAWTMRLLLTQLYDPAPEITEVAVQFLEEV
CESKEFLQMVVELQPAMSHLGDIGDALLLKFMSTSMGFRYLFEAGHIEKEIDNWFHERNLLYVVDIEIFLTKLFN
TALIEDKEDLLVSVGGMPRHFYGEMVKTDIGCQILQEKGHFKEFSQVIRQHNLEAEDMELIMRLKSILWAVGNVG
STEGGLPFLEEENIIPVILETAEQSPIPSVRGTCFFVLGLISSTTQGAEILEDYDWLSTLSPLGTPTGVCLPSDF
ETFITIPGWEQFIPEKQNYRLIPPAFDYEIEIVTAMQNMANTVIANAASRTLAKFRSRPEYRKAFSSPDMFYRAL
HMLSTQRYRLPVRRYILDLFNLEMNPETVAALERSAEALKAEPSYKPSSATITRMSIFGRLGRTKRPSESESSED
GDESFTGNASHDVLKEQGPVLKLKPVLKVVGFDESYNLRINSSIQGLMFARDGSVGMFVRRHSDENQVIQLQSDA
LPTELRSVVNQDAIETIMMRLQMQIRANIEYTLLTANPVYIKSMSLLRACVQATAVSRKAPIQCTSLLSRGMANE
STPAKKDSSEIVAPEPAREVLVADVISGAPSQLKHRAVRIYQPTRNTMQSGGAKMERWRIDFDILQGGGRWENPL
MGYASSADYMQGTRMSFRSKEDAMHFAEKQGWDYYVQPQVIKRIPPKNYAENFVYKPHKLRILRTK*
Coding >Agabi119p4|103720
ATGCCCGCGCAACTCGCGTTTCCTTCACAACCACCATCTAATCTCTCTTTAAACAGCAACAACAACAACCATCGA
CCGACCAATGCACTCGAAATCCTGCTGGACTCGAATGCAGAACCAGCGAAAGAGATGGAAAGACTAGAGAATTTG
CTTGTACGGGAACACCGAATCCTCGAAGGCGCCGAAACGTTTCTGAAAATGGAGCTGTCGGAAATCTCGCGAAAG
AAAGTTGAATCTGAAATGGCCATGGCGCGGAAGAATATCATGGTAGTCAATCAATCACTAGGCCTTCTGAGGGAC
AGGCAAGTTACAGAAGATGCGGTTATACAGCGCAAAAGGACACAAGAGAGTCTAGTTATGGGGAATGGAACAGGG
GTAGAGGATAGAAGTGTGGAAGACTTTCGTACGGCTCTCCAACGCGCCCACAAATACTTTGTCGAATTGGATCTT
CTAAGTCGTTCACGATCACACCAATCCGCTTTCGCGGCCGGCTCTTCCTCCAATGACGTTACAGCGTCCGAATCA
TTTGAGATTGACAGACATCGCGTCGAGATTATGAATCGTATTGTTGAGATTCAGCAACGGAACCTGCGCGTTCGG
TATGAGTTGAAGCTTTCGGATGTATTGAAGTCGATTGTGCCGTGCTTGGCCGACAAGTGCTCTAAAGCGTGTCGT
GCAGCTGCGTATCGACTAATTCGACATGCCTTGGTAGAAGCAGAGTCTGTTCAGCGATTAGGGACCACCCTTGAT
TGGTATATCGTCAAATCCCTTACGCGTGACAATAAATTCGCTGTAGAGAAGGAACAAGCTATCAAGCTAGTCCGA
ACGATCGTAGAAGTCGGAACGACACATAGAGATTCTCCTGTTTCAAGTGGAGTCGCAGTAATAGCCATTTCGGAC
GCTGTCCTGCGTGCTATCACCGCTGTTGCAGAAAATATCGATGACCCGTTCCGAACGATATGTATCGAAACTTTG
ACTGAAATTCTTCTCATCGACATTGATTCTCTCACTCGTACGGGCGGCCTTCGTCTTCTCTTGCAGGTTTTGGGG
GACGGGCCTCCGGAACTTGCGCCTCTGCTAGCGGCTGCCTTCCTGCAAATTGTTGACTCACCCCGGACACGTACA
TATCTGAGGATCGGTTGTGATATCGAGGCTGTGCTGTCTATAATAACAGATGCTTACGGGAAAGGTGTTGATCAT
GCGGAACGAATGCGTGGGTGTTCAAAAGTGATACAGCTGATGTTGCATTCTTGGAGCGGGCTCATGTATTTTGCC
ATCAATGATATGCAAGCGATACGCTCTGTCATTGACACTTTACGAATACCGTCGTTGGAGACGAGAGAAGTCATA
TTAGATATGTTTTTCGAGCTACTCAACATAAAGACGTCGGATTGGTATCAAACGTTTATCTCTGGACGAAGATTA
ACTATGTATCGAAAGTCAGGTGTTCAGCAGGATAAGAAATCCTCAGCTCCTGAAGCGCAAGAACGTTCTCATCAG
TTCGTCAAGTTGACTGACCAATTTCTTGCATTGTTGGTTATGGTACTAACGAAGGCTGGTCTCTGTGAGGCTCTT
ACTTGCTTATTGGAGGAGACGAGGATTGGTTCGAGTTTGTCTCGGAAAGCAACACTTCTCTTGGCTGAAATACTT
GCCCTCGCAACAAGGGTATTACCGATGAACGCTGCTGCCAGCATTCAGGCAATACCAGCAGTCTTTTCTATGGCC
ACTGATTATGATGATGGAGAACATCGGATTGTTGGCACTTCTGCGTTATCAGCAATCGAGAGTTTTAACCGTAAT
AGGACGCGATTGGACAACAACACAGCTCTCAAGTATACCCGTCCGCGCGCCAACTCTGTCGAGGATCCTGTAAGG
CGAGGGCAAAGACACGTGGAACAAGTAAAAGTGAAGATGAGCATGCAGATGGACGATCGAACGTTTCAAACTGCT
GTCATTGAAACACAAGTGATGCAAACTAAAGATTTCACGAAGTGGAACTATGAAGCACTTCAAGACGTTGTGGAT
GGGTTGATGTATAACCAAAAACGTCTAGAAGAAGTTATCAAAGCGAGATTTATTCGAAGGTTGATGTCGTTTTAT
TCGCCATTTAATCATCGTTTTTCGGATATACCAAGAATTAGGGATACAGTGAAATGGGTGAAGTTAGGATGTTCG
TTGTTGACGACGTTGATGTCGGGAGGTGAAGGGGTGCGGTATCTGGGGAATGAGGATCAACTTTTAAGCCAGATT
GTAAGAGGCTTTGCTCAGCTTGATCCTTTCAATGGTCCTCCGGATTCGGATCCAATTTTCTCTAAGAAACGGGTG
GCGGAAACATTGACCTACGGGTATTTTGAGATGTTGGGTACCTTAAGCAGATACGAGAAAGGAATTGAGTTGCTT
GAGAAGTTTAAAGTCTTTACGGCTTTCTATCACTTGAATGAGTTGCGGAGCCGGGAAGATCTGATCAAAAGCATC
ATTGAGAATTTGGACTACAGCATTGACGGCCATTCACGCATCATTTTATCGAAAGCCCTCACATCCAGTTACAAA
CACATTCGTTTATATGCCACGGAGCATCTAGGTTCCCTGATTCGTAGCTCCATCACAGCGAATGCATGGACAATG
CGACTTCTGCTGACGCAGCTATATGACCCTGCGCCCGAAATCACGGAGGTTGCTGTGCAATTTCTCGAGGAAGTC
TGCGAATCGAAGGAGTTTTTGCAGATGGTGGTTGAGTTACAGCCTGCTATGAGTCATTTGGGGGACATTGGTGAT
GCCCTCCTTTTGAAGTTCATGTCTACCTCCATGGGCTTCAGGTATCTGTTCGAGGCTGGACATATCGAAAAAGAG
ATTGATAATTGGTTTCATGAACGGAACTTGTTGTATGTCGTCGACATTGAGATTTTTCTCACAAAATTATTCAAT
ACGGCACTCATCGAAGACAAGGAAGATCTATTGGTATCTGTTGGTGGCATGCCGCGACATTTTTATGGCGAAATG
GTAAAGACGGATATTGGATGTCAGATATTACAGGAGAAAGGACATTTCAAAGAGTTTTCACAAGTCATTCGCCAA
CATAACTTGGAGGCTGAGGACATGGAGCTTATCATGAGGTTGAAAAGTATACTTTGGGCTGTGGGTAATGTTGGA
TCTACTGAAGGTGGATTACCATTTCTTGAGGAAGAAAACATAATTCCTGTCATTTTGGAGACTGCTGAACAATCT
CCCATTCCTTCTGTTCGAGGAACTTGTTTCTTCGTGTTGGGTCTGATCTCTTCAACAACGCAAGGCGCTGAGATT
TTGGAAGACTATGATTGGTTATCGACGCTGTCGCCGTTAGGGACTCCAACCGGCGTTTGTTTACCTTCGGACTTC
GAGACTTTCATCACGATACCTGGCTGGGAGCAGTTCATTCCCGAGAAACAGAATTATCGTTTGATACCACCTGCG
TTCGACTATGAGATCGAAATCGTAACTGCCATGCAGAATATGGCCAATACGGTTATCGCGAATGCGGCTTCAAGG
ACATTGGCAAAGTTTCGATCCCGCCCCGAGTACAGGAAAGCTTTTAGTTCGCCTGATATGTTTTATAGGGCATTG
CATATGCTCTCTACGCAGCGATATCGGTTACCTGTTCGACGGTACATTTTGGATTTGTTCAACCTGGAAATGAAC
CCCGAAACTGTGGCAGCTCTGGAACGAAGTGCGGAAGCGCTCAAAGCTGAGCCGTCATATAAACCCTCTAGTGCG
ACGATTACTCGCATGAGCATATTTGGGAGGTTGGGGAGGACGAAGCGGCCTTCGGAGAGTGAGTCGTCGGAGGAT
GGCGATGAGTCTTTTACGGGTAATGCATCTCATGATGTGTTGAAGGAGCAAGGCCCGGTGTTGAAGTTGAAACCT
GTTCTGAAAGTTGTTGGATTTGATGAATCTTACAATCTTAGGATTAACTCATCTATTCAGGGTTTGATGTTCGCA
AGAGACGGGTCTGTTGGAATGTTTGTTCGGCGACATTCAGATGAAAATCAAGTTATCCAATTACAGTCTGACGCT
CTTCCAACTGAGCTAAGGTCGGTTGTTAATCAAGACGCCATCGAAACAATTATGATGCGACTGCAGATGCAAATA
CGTGCAAATATAGAATACACCTTGCTCACCGCCAACCCCGTTTACATCAAATCCATGTCCCTCCTTCGAGCCTGT
GTACAGGCTACCGCTGTCTCTAGGAAAGCTCCTATACAATGCACTTCGTTACTTAGTCGCGGCATGGCAAATGAG
TCGACTCCTGCAAAGAAAGATTCCTCGGAGATTGTCGCGCCGGAACCCGCTCGTGAAGTCCTGGTCGCTGATGTG
ATAAGTGGTGCACCAAGTCAACTGAAACACCGCGCTGTGCGCATTTATCAACCGACGAGGAACACTATGCAGAGC
GGAGGAGCAAAGATGGAACGTTGGCGTATTGACTTTGATATCTTACAGGGTGGAGGTCGTTGGGAGAATCCTTTG
ATGGGATACGCTAGCTCTGCGGACTACATGCAAGGCACACGCATGTCCTTCCGATCGAAAGAAGACGCCATGCAT
TTTGCAGAGAAGCAAGGATGGGACTATTATGTTCAACCTCAAGTTATCAAGAGGATTCCGCCAAAGAATTATGCG
GAGAACTTTGTCTACAAGCCACACAAGCTTCGTATTCTGAGGACGAAGTAG
Transcript >Agabi119p4|103720
ATGCCCGCGCAACTCGCGTTTCCTTCACAACCACCATCTAATCTCTCTTTAAACAGCAACAACAACAACCATCGA
CCGACCAATGCACTCGAAATCCTGCTGGACTCGAATGCAGAACCAGCGAAAGAGATGGAAAGACTAGAGAATTTG
CTTGTACGGGAACACCGAATCCTCGAAGGCGCCGAAACGTTTCTGAAAATGGAGCTGTCGGAAATCTCGCGAAAG
AAAGTTGAATCTGAAATGGCCATGGCGCGGAAGAATATCATGGTAGTCAATCAATCACTAGGCCTTCTGAGGGAC
AGGCAAGTTACAGAAGATGCGGTTATACAGCGCAAAAGGACACAAGAGAGTCTAGTTATGGGGAATGGAACAGGG
GTAGAGGATAGAAGTGTGGAAGACTTTCGTACGGCTCTCCAACGCGCCCACAAATACTTTGTCGAATTGGATCTT
CTAAGTCGTTCACGATCACACCAATCCGCTTTCGCGGCCGGCTCTTCCTCCAATGACGTTACAGCGTCCGAATCA
TTTGAGATTGACAGACATCGCGTCGAGATTATGAATCGTATTGTTGAGATTCAGCAACGGAACCTGCGCGTTCGG
TATGAGTTGAAGCTTTCGGATGTATTGAAGTCGATTGTGCCGTGCTTGGCCGACAAGTGCTCTAAAGCGTGTCGT
GCAGCTGCGTATCGACTAATTCGACATGCCTTGGTAGAAGCAGAGTCTGTTCAGCGATTAGGGACCACCCTTGAT
TGGTATATCGTCAAATCCCTTACGCGTGACAATAAATTCGCTGTAGAGAAGGAACAAGCTATCAAGCTAGTCCGA
ACGATCGTAGAAGTCGGAACGACACATAGAGATTCTCCTGTTTCAAGTGGAGTCGCAGTAATAGCCATTTCGGAC
GCTGTCCTGCGTGCTATCACCGCTGTTGCAGAAAATATCGATGACCCGTTCCGAACGATATGTATCGAAACTTTG
ACTGAAATTCTTCTCATCGACATTGATTCTCTCACTCGTACGGGCGGCCTTCGTCTTCTCTTGCAGGTTTTGGGG
GACGGGCCTCCGGAACTTGCGCCTCTGCTAGCGGCTGCCTTCCTGCAAATTGTTGACTCACCCCGGACACGTACA
TATCTGAGGATCGGTTGTGATATCGAGGCTGTGCTGTCTATAATAACAGATGCTTACGGGAAAGGTGTTGATCAT
GCGGAACGAATGCGTGGGTGTTCAAAAGTGATACAGCTGATGTTGCATTCTTGGAGCGGGCTCATGTATTTTGCC
ATCAATGATATGCAAGCGATACGCTCTGTCATTGACACTTTACGAATACCGTCGTTGGAGACGAGAGAAGTCATA
TTAGATATGTTTTTCGAGCTACTCAACATAAAGACGTCGGATTGGTATCAAACGTTTATCTCTGGACGAAGATTA
ACTATGTATCGAAAGTCAGGTGTTCAGCAGGATAAGAAATCCTCAGCTCCTGAAGCGCAAGAACGTTCTCATCAG
TTCGTCAAGTTGACTGACCAATTTCTTGCATTGTTGGTTATGGTACTAACGAAGGCTGGTCTCTGTGAGGCTCTT
ACTTGCTTATTGGAGGAGACGAGGATTGGTTCGAGTTTGTCTCGGAAAGCAACACTTCTCTTGGCTGAAATACTT
GCCCTCGCAACAAGGGTATTACCGATGAACGCTGCTGCCAGCATTCAGGCAATACCAGCAGTCTTTTCTATGGCC
ACTGATTATGATGATGGAGAACATCGGATTGTTGGCACTTCTGCGTTATCAGCAATCGAGAGTTTTAACCGTAAT
AGGACGCGATTGGACAACAACACAGCTCTCAAGTATACCCGTCCGCGCGCCAACTCTGTCGAGGATCCTGTAAGG
CGAGGGCAAAGACACGTGGAACAAGTAAAAGTGAAGATGAGCATGCAGATGGACGATCGAACGTTTCAAACTGCT
GTCATTGAAACACAAGTGATGCAAACTAAAGATTTCACGAAGTGGAACTATGAAGCACTTCAAGACGTTGTGGAT
GGGTTGATGTATAACCAAAAACGTCTAGAAGAAGTTATCAAAGCGAGATTTATTCGAAGGTTGATGTCGTTTTAT
TCGCCATTTAATCATCGTTTTTCGGATATACCAAGAATTAGGGATACAGTGAAATGGGTGAAGTTAGGATGTTCG
TTGTTGACGACGTTGATGTCGGGAGGTGAAGGGGTGCGGTATCTGGGGAATGAGGATCAACTTTTAAGCCAGATT
GTAAGAGGCTTTGCTCAGCTTGATCCTTTCAATGGTCCTCCGGATTCGGATCCAATTTTCTCTAAGAAACGGGTG
GCGGAAACATTGACCTACGGGTATTTTGAGATGTTGGGTACCTTAAGCAGATACGAGAAAGGAATTGAGTTGCTT
GAGAAGTTTAAAGTCTTTACGGCTTTCTATCACTTGAATGAGTTGCGGAGCCGGGAAGATCTGATCAAAAGCATC
ATTGAGAATTTGGACTACAGCATTGACGGCCATTCACGCATCATTTTATCGAAAGCCCTCACATCCAGTTACAAA
CACATTCGTTTATATGCCACGGAGCATCTAGGTTCCCTGATTCGTAGCTCCATCACAGCGAATGCATGGACAATG
CGACTTCTGCTGACGCAGCTATATGACCCTGCGCCCGAAATCACGGAGGTTGCTGTGCAATTTCTCGAGGAAGTC
TGCGAATCGAAGGAGTTTTTGCAGATGGTGGTTGAGTTACAGCCTGCTATGAGTCATTTGGGGGACATTGGTGAT
GCCCTCCTTTTGAAGTTCATGTCTACCTCCATGGGCTTCAGGTATCTGTTCGAGGCTGGACATATCGAAAAAGAG
ATTGATAATTGGTTTCATGAACGGAACTTGTTGTATGTCGTCGACATTGAGATTTTTCTCACAAAATTATTCAAT
ACGGCACTCATCGAAGACAAGGAAGATCTATTGGTATCTGTTGGTGGCATGCCGCGACATTTTTATGGCGAAATG
GTAAAGACGGATATTGGATGTCAGATATTACAGGAGAAAGGACATTTCAAAGAGTTTTCACAAGTCATTCGCCAA
CATAACTTGGAGGCTGAGGACATGGAGCTTATCATGAGGTTGAAAAGTATACTTTGGGCTGTGGGTAATGTTGGA
TCTACTGAAGGTGGATTACCATTTCTTGAGGAAGAAAACATAATTCCTGTCATTTTGGAGACTGCTGAACAATCT
CCCATTCCTTCTGTTCGAGGAACTTGTTTCTTCGTGTTGGGTCTGATCTCTTCAACAACGCAAGGCGCTGAGATT
TTGGAAGACTATGATTGGTTATCGACGCTGTCGCCGTTAGGGACTCCAACCGGCGTTTGTTTACCTTCGGACTTC
GAGACTTTCATCACGATACCTGGCTGGGAGCAGTTCATTCCCGAGAAACAGAATTATCGTTTGATACCACCTGCG
TTCGACTATGAGATCGAAATCGTAACTGCCATGCAGAATATGGCCAATACGGTTATCGCGAATGCGGCTTCAAGG
ACATTGGCAAAGTTTCGATCCCGCCCCGAGTACAGGAAAGCTTTTAGTTCGCCTGATATGTTTTATAGGGCATTG
CATATGCTCTCTACGCAGCGATATCGGTTACCTGTTCGACGGTACATTTTGGATTTGTTCAACCTGGAAATGAAC
CCCGAAACTGTGGCAGCTCTGGAACGAAGTGCGGAAGCGCTCAAAGCTGAGCCGTCATATAAACCCTCTAGTGCG
ACGATTACTCGCATGAGCATATTTGGGAGGTTGGGGAGGACGAAGCGGCCTTCGGAGAGTGAGTCGTCGGAGGAT
GGCGATGAGTCTTTTACGGGTAATGCATCTCATGATGTGTTGAAGGAGCAAGGCCCGGTGTTGAAGTTGAAACCT
GTTCTGAAAGTTGTTGGATTTGATGAATCTTACAATCTTAGGATTAACTCATCTATTCAGGGTTTGATGTTCGCA
AGAGACGGGTCTGTTGGAATGTTTGTTCGGCGACATTCAGATGAAAATCAAGTTATCCAATTACAGTCTGACGCT
CTTCCAACTGAGCTAAGGTCGGTTGTTAATCAAGACGCCATCGAAACAATTATGATGCGACTGCAGATGCAAATA
CGTGCAAATATAGAATACACCTTGCTCACCGCCAACCCCGTTTACATCAAATCCATGTCCCTCCTTCGAGCCTGT
GTACAGGCTACCGCTGTCTCTAGGAAAGCTCCTATACAATGCACTTCGTTACTTAGTCGCGGCATGGCAAATGAG
TCGACTCCTGCAAAGAAAGATTCCTCGGAGATTGTCGCGCCGGAACCCGCTCGTGAAGTCCTGGTCGCTGATGTG
ATAAGTGGTGCACCAAGTCAACTGAAACACCGCGCTGTGCGCATTTATCAACCGACGAGGAACACTATGCAGAGC
GGAGGAGCAAAGATGGAACGTTGGCGTATTGACTTTGATATCTTACAGGGTGGAGGTCGTTGGGAGAATCCTTTG
ATGGGATACGCTAGCTCTGCGGACTACATGCAAGGCACACGCATGTCCTTCCGATCGAAAGAAGACGCCATGCAT
TTTGCAGAGAAGCAAGGATGGGACTATTATGTTCAACCTCAAGTTATCAAGAGGATTCCGCCAAAGAATTATGCG
GAGAACTTTGTCTACAAGCCACACAAGCTTCGTATTCTGAGGACGAAGTAG
Gene >Agabi119p4|103720
ATGCCCGCGCAACTCGCGTTTCCTTCACAACCACCATCTAATCTCTCTTTAAACAGCAACAACAACAACCATCGA
CCGACCAATGCACTCGAAATCCTGCTGGACTCGAATGCAGAACCAGCGAAAGAGGTGCTTAAATGCAATTTTGTT
ATTACATGTTTAGAGAGCGTTGATTTTCATACTTTAGATGGAAAGACTAGAGAATTTGCTTGTACGGGAACACCG
AATCCTCGAAGGCGCCGAAACGTTTCTGAAAATGGAGCTGTCGGTGAGATATACCACCACCTTGTTTTTTTCTGG
GTTTGTGCTGTAGTCATATCTGAGATTGATATTTGGTTTGATCTAGGAAATCTCGCGAAAGAAAGTTGAATCTGA
AATGGCCATGGCGCGGAAGAATATCATGGTAGTCAATCAATCACTAGGCCTTCGTACGCTTTTCAACTATTTCCT
TTTTTTATTCGGCTTACACAACTGACGCGTTATGCCATAGTGAGGGACAGGCAAGTTACAGAAGATGCGGTTATA
CAGCGCAAAAGGACACAAGAGAGTCTAGTTATGGGGAATGGAACAGGGGTAGAGGATAGAAGTGAGTGCAAGTAT
TTGCCTTCTGTACGACATACTCAAATTATCCTTCTTTCAAGGTGTGGAAGACTTTCGTACGGCTCTCCAACGCGC
CCACAAATACTTTGTCGAATTGGATCTTCTAAGTCGTTCACGATCACACCAATCCGCTTTCGCGGCCGGCTCTTC
CTCCAATGACGTTACAGCGTCCGAATCATTTGAGATTGACAGACATCGCGTCGAGATTATGAATCGTATTGTTGA
GATTCAGCAACGGAACCTGCGCGTTCGGTATGAGTTGAAGCTTTCGGATGTATTGAAGTCGTACGTGGCATGTCT
ATTTTTTCCACCATTTTGGAGCGCTTACTGTTCTATTCTGGAATAGGATTGTGCCGTGCTTGGCCGACAAGTGCT
CTAAAGCGTGTCGTGCAGCTGCGTATCGACTAATTCGACATGCCTTGGTAGAAGCAGAGTCTGTTCAGCGATTAG
GGACCACCCTTGATTGGTATATCGTCAAGTAAAAACCCATGCTCATATCGTTTCTGCATACGTGACATTCATGTC
TTATCAGATCCCTTACGCGTGACAATAAATTCGCTGTAGAGAAGGAACAAGCTATCAAGCTAGTCCGAACGATCG
TAGAAGTCGGAACGACACATAGAGATTCTCCTGTTTCAAGTGGAGTCGCAGTAATAGCCATTTCGGACGCTGTCC
TGCGTGCTATCACCGCTGTTGCAGAAAATATCGATGACCCGTTCCGAACGATATGTATCGAAACTTTGACTGAAA
TTCGTGAGCCGCTGCTCAACGCGTTTTGTATGGCCTCTAACTGACTTTTTTTTACACCAGTTCTCATCGACATTG
ATTCTCTCACTCGTACGGGCGGCCTTCGTCTTCTCTTGCAGGTTTTGGGGGACGGGCCTCCGGAACTTGCGCCTC
TGCTAGCGGCTGCCTTCCTGCAAATTGTTGACTCACCCCGGACACGTACATATCTGAGGATCGGTTGTGATATCG
AGGTGAGCTCATTGCCACATATCCCCTATCATTTTGCACTTATATTGGGCTCCCCCCAAAGGCTGTGCTGTCTAT
AATAACAGATGCTTACGGGAAAGGTGTTGATCATGCGGAACGAATGCGTGGGTGTTCAAAAGTGATACAGCTGAT
GTTGCATTCTTGGAGCGGTACGTTAAATGACAGAGCGACCTTTCATTCTAGATGTTTATGTTGACCCGGTATAAT
TTACAGGGCTCATGTATTTTGCCATCAATGATATGCAAGCGATACGCTCTGTCATTGACACTTTACGAATACCGT
CGTTGGAGACGAGAGTCAGTGTCACAATTTGCTTTTCAATCTTGTTGCTCTAAATATTTAGGACAGGAAGTCATA
TTAGATATGTTTTTCGAGCTACTCAACATAAAGACGTCGGATTGGTATCAAACGTTTATCTCTGGACGAAGATTA
ACTAGTGAGTGAATCTTTATTCCAGGTGAAGTTTACACACAGATGTATATACGTACTTTGCAGTGTATCGAAAGT
CAGGTGTTCAGCAGGATAAGAAATCCTCAGCTCCTGAAGCGCAAGAACGTTCTCATCAGTTCGTCAAGTTGACTG
ACCAATTTCTTGCATTGTTGGTTATGGTACTAACGAAGGCTGGTCTCTGTGAGGTACGTGGTGTGTGCTTGATTT
TGCATCAATCTCTGACTATCGGTCTGTGCTTATACCATAGGCTCTTACTTGCTTATTGGAGGAGACGAGGATTGG
TTCGAGTTTGTCTCGGAAAGCAACACTTCTCTTGGCTGAAATACTTGCCCTCGCAACAAGGGTATTACCGATGAA
CGCTGCTGCCAGCATTCAGGTAGGATCACGAAAGCATTTGCAGATAGTCCGCAGCTCATTCTTTTGTATATTGAA
GGCAATACCAGCAGTCTTTTCTATGGCCACTGATTATGATGATGGAGAACATCGGATTGTTGGCACTTCTGCGTT
ATCAGCAATCGAGAGTTTTAACCGTAATAGGACGCGATTGGACAACAACACAGCTCTCAAGTATACCCGTCCGCG
GTACGTTCCTAGTTACACGTGTTTAGTTCGAAATGTTGATCTAACGCTTTTAGCGCCAACTCTGTCGAGGATCCT
GTAAGGCGAGGGCAAAGACACGTGGAACAAGTAAAAGTGAAGATGAGCATGCAGATGGACGATCGAACGTTTCAA
ACTGCTGTCATTGAAACACAAGTGATGCAAACTAAAGATTTCACGAAGTGGAACTATGAAGCACTTCAAGACGTT
GTGGATGGGTTGATGTATAACCAAAAACGTCTAGAAGAAGTTATCAAAGCGAGATTTATTCGAAGGTTGATGTCG
TTTTATTCGCCATTTAATCATCGTTTTTCGGATATACCAAGAATTAGGGTGAATTACTTTCTTCTTCTTCTATTA
ATTGAGCTGACGTCGAAATTGTTGAATTCTACGCTGTGGCATAGGATACAGTGAAATGGGTGAAGTTAGGATGTT
CGTTGTTGACGACGTTGATGTCGGGAGGTGAAGGGGTGCGGTATCTGGGGAATGAGGATCAACTTTTAAGCCAGA
TTGTAAGAGGCTTTGCTCAGCTTGATCCTGTAAGCACCTTTTCCCTCGTTACTTGCATATCTGCTAATAATTTAC
TTGATTCGAAAGTTCAATGGTCCTCCGGATTCGGATCCAATTTTCTCTAAGAAACGGGTGGCGGAAACATTGACC
TACGGGTATTTTGAGATGTTGGGTACCTTAAGCAGATACGAGAAAGGAATTGAGTGAGTGTTTTATGACATGTTC
CCGTGTGGGTTTCGAAATGATTTAACTTGGGATAGGTTGCTTGAGAAGTTTAAAGTCTTTACGGCTTTCTATCAC
TTGAATGAGTTGCGGAGCCGGGAAGATCTGATCAAAAGCATCATTGAGAATTTGGACTACAGCATGTATGCCTAT
GTGCTTCGAATATCTCATTCGGATCACTTATCGCGCGATTTACCTAGTGACGGCCATTCACGCATCATTTTATCG
AAAGCCCTCACATCCAGTTACAAAGTGAGTCACTATCTCTCCTCCATGCCTTTACCCGCACGTTGACACACGATG
TGTATAGCACATTCGTTTATATGCCACGGAGCATCTAGGTTCCCTGATTCGTAGCTCCATCACAGCGAATGCATG
GACAATGCGACTTCTGCTGACGCAGCTATATGACCCTGCGCCCGAAATCACGGAGGTTGCTGTGCAATTTCTCGA
GGAAGTCTGCGAATCGAAGGAGTTTTTGCAGATGGTGGTTGAGTTACAGCCTGCTATGAGTCATTTGGGGGACAT
TGGTGATGCCCTCCTTTTGAAGTGAGTCTCTTTGGTTTTCTGGTGTAGCCTGATCACTGAATTGATTCTTTTCTC
TCGTAGGTTCATGTCTACCTCCATGGGCTTCAGGTATCTGTTCGAGGCTGGACATATCGAAAAAGAGATTGATAA
TTGGTTTCATGTCAGTATCGTTATGCTTTACATTCCCTTATATGCTCAATCTTGTGACATAGGAACGGAACTTGT
TGTATGTCGTCGACATTGAGATTTTTCTCACAAAATTATTCAATACGGCACTCATCGAAGACAAGGAAGATCTAT
TGTAGGCTGATCTCTATGGCGAGAGTAGCTGTAACTCATCCTAGCTAGGGTATCTGTTGGTGGCATGCCGCGACA
TTTTTATGGCGAAATGGTAAAGACGGATATTGGATGTCAGATATTACAGGAGAAAGGACATTTCAAAGAGTTTTC
ACAAGTCATTCGCCAACATAACTTGGAGGCTGAGGACATGGAGCTTATCATGAGGTTGAAAAGTATACTTTGGGC
TGTGGTACGCGATTTTGTTTCCCTTTCTTTTGCGTTCGGGTGCATATGCTGATCAGTATTAAAAGGGTAATGTTG
GATCTACTGAAGGTGGATTACCATTTCTTGAGGAAGAAAACATAATTCCTGTCATTTTGGAGACTGCTGAACAAT
CTCCCATTCCTTCTGTTCGAGGGTGAGTCCTTCCCCAAAATAACATCTGGAGATTCCGTCTGATTAATGGGCTTG
TAGAACTTGTTTCTTCGTGTTGGGTCTGATCTCTTCAACAACGCAAGGCGCTGAGATTTTGGAAGACTATGATTG
GTTATCGACGCTGTCGCCGTTAGGGACTCCAACCGGCGTTTGTTTACCTTCGGACTTCGAGACTTTCATCACGGT
GAGTCGAAAAGTCCTGTTTTAGCTGGTTCTATGCTAAGAATGGCTTGTAGATACCTGGCTGGGAGCAGTTCATTC
CCGAGAAACAGAATTATCGTTTGATACCACCTGCGTTCGACTATGAGATCGAAATCGTAACTGCCATGCAGAATA
TGGCCAATACGGTTATCGCGAATGCGGCTTCAAGGACATTGGCAAAGTATGAACAAAAAGTCTGGATTTTGAATG
ACGTACTAAACGAGTTTATGGAACTAGGTTTCGATCCCGCCCCGAGTACAGGAAAGCTTTTAGTTCGCCTGATAT
GTTTTATAGGGCATTGCATATGCTCTCTACGCAGCGATATCGGTTACCTGTTCGACGGTACATTTTGGATTTGTT
CAACCTGGAAATGAACCCCGAAACTGTGGCAGCTCTGGAACGAAGTGCGGAAGCGCTCAAAGCTGAGCCGTCATA
TAAACCCTCTAGTGCGACGATTACTCGCATGAGCATATTTGGGAGGTTGGGGAGGACGAAGCGGCCTTCGGAGAG
TGAGTCGTCGGAGGATGGCGATGAGTCTTTTACGGGTAATGCATCTCATGATGTGTTGAAGGAGCAAGGCCCGGT
GTTGAAGTTGAAACCTGTTCTGAAAGTTGTTGGATTTGATGTATGATCTTGGTTTTTTGTATAAATGTTTTCTGG
CATGGGACTTTGTTGTATAGGAATCTTACAATCTTAGGATTAACTCATCTATTCAGGGTTTGATGTTCGCAAGAG
ACGGGTCTGTTGGAATGTTTGTTCGGTAAAAATTGCTAAATGGCTAGTCAAGAAAAAAGATTAGATTAGTCCGAC
CTGCCTGGTTCGAACAGGCGACATTCAGATGAAAATCAAGTTATCCAATTACAGTCTGACGCTCTTCCAACTGAG
CTAAGGTCGGTTGTTAATCAAGACGCCATCGAAACAATTATGATGCGACTGCAGATGCAAATACGTGCAAATATA
GAATACACCTTGCTCACCGCCAACCCCGTTTACATCAAATCCATGTCCCTCCTTCGAGCCTGTGTACAGGCTACC
GCTGTCTCTAGGAAAGCTCCTATACAATGCACTTCGTTACTTAGTCGCGGCATGGCAAATGAGTCGACTCCTGCA
AAGAAAGATTCCTCGGAGATTGTCGCGCCGGAACCCGCTCGTGAAGTCCTGGTCGCTGATGTGATAAGTGGTGCA
CCAAGTGCGTAGTTTGTCGTTGTGAATCTGTTTGCAAATTTTAATTTGCGTTTATGACCAGGTCAACTGAAACAC
CGCGCTGTGCGCATTTATCAACCGACGAGGAACACTATGCAGAGCGGAGGAGCAAAGATGGAACGTTGGCGTATT
GACTTTGATATCTTACAGGGTGGAGGTCGTTGGGAGAATCCTTTGATGGGATACGCTAGCTCGTGAGTCCAGGAG
GTTAGAAAATCCAACTTTAACCATGGGCTAACCCCTTCATTCATGTTAGTGCGGACTACATGCAAGGCACACGCA
TGTCCTTCCGATCGAAAGAAGACGCCATGCATTTTGCAGAGAAGCAAGGTGCGTCCGTTCTTGATTATCCAAAAC
AACGGTAGGTTTACTGGCTCTTACTACCTAGGATGGGACTATTATGTGTGAGTCTCCAGCTACCCTGTAGTTCCG
CAGTCCGCTCCAGAGCTAACGGTTTTTTGTCCAGTCAACCTCAAGTTATCAAGAGGATTCCGCCAAAGAATTATG
CGGAGAACTTTGTCTACAAGCCACACAAGCTTCGTATTCTGAGGACGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail